KEGG   Saccharophagus degradans: Sde_1480Help
Entry
Sde_1480          CDS       T00335                                 

Definition
carbohydrate kinase, FGGY
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sde  Saccharophagus degradans
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sde00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Sde_1480
Enzymes [BR:sde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Sde_1480
Exosome [BR:sde04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sde_1480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1906081..1907556
Genome map
AA seq 491 aa AA seqDB search
MSENCILSIDIGTHSTRVAIINTRGQILWLKKFSYTLHYINEAFIEQDAWPIVEHLKGLI
DEATQTEFSICAAGIACQRSTVLAWDSETGKPLHAALSWMDTRAKGEVTALARQQKAIKQ
KTGLVLSPHYGATKLAWLQRHLTENGERVFQMGPLISFVLFHLVAGRPFICDESNAARTQ
LYDIYTRNWSLSLKQLFGVGTGLLPQVLPCCANYGNIMNARGKSIPLVAVSGDQNAAYFA
LHSLEVFRKGGAVVANLGTGAFLLVETHLEHSPSNLLHTLLYSSEGSVQYALEATINGAG
SAVEWLCEQWIRAGVREGASTERDRDQFFKELALWFERYQTADVKIPVFINTLGGVAAPY
WRQDIPHNFIGVSDSSSWYAKAMAVFESIAFWVRRNVEEIEASRPVKLLVVSGGLLVNNG
FRQMLASAVGKKVVVNTQLESTLVGVAGLAFAQLGQSITVDDSQTSTVYSPIFCDELEER
YQTFKHYLDNY
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaaactgcattctctcgattgatattggcacccattcaactcgcgtagcaata
attaacacgcgcggccaaatactttggttaaaaaaattttcttacactttacattatata
aacgaagcttttatagaacaggatgcatggcccatagtcgaacaccttaaaggtttgatc
gacgaagccacgcaaacagagttttctatctgcgctgcaggtattgcttgtcagcgttca
actgtattggcatgggatagtgagaccggcaagcccctgcatgcagcgttaagctggatg
gatacccgcgcgaagggtgaagtaacagctttagcaaggcagcagaaggcaattaagcaa
aaaactgggctggtattgtcgccacattacggtgctacaaaactcgcttggttacagcgc
catttaaccgaaaatggcgagcgtgttttccaaatggggccgctcataagttttgttttg
ttccatcttgtggctggccgcccttttatttgcgatgaaagtaatgctgccagaacgcaa
ctttacgatatctatacccgcaactggagcttgtcgctaaagcagttgtttggggtaggc
actgggcttttgccgcaagtattaccctgttgtgcaaattacggcaatataatgaacgca
cgtggtaaatctatccctcttgttgccgtaagtggagaccagaatgccgcttactttgca
ctgcacagcttagaggtttttcgcaagggtggcgcggttgtggctaacttaggtacaggt
gcatttttacttgtagaaacccatctagagcactcgccatcgaacttgcttcatacgttg
ctctatagttctgagggcagtgtacagtacgcattggaggccacaatcaatggcgccggt
agtgcagtagaatggctgtgcgagcaatggataagagcgggtgttagagaaggggcgagc
accgagcgcgaccgtgatcaattctttaaagagctggctttatggtttgagcggtatcaa
acagcagacgttaaaatacccgtatttattaatactctagggggcgtggccgcaccctat
tggcggcaggatatacctcataattttataggtgttagcgactcgtctagttggtacgct
aaagctatggcggtgttcgaaagtattgcgttttgggtgcggcgtaacgtagaagaaata
gaggcgtcacgtccagttaaattgcttgtagtcagcggcgggctattggtgaataatggt
ttcaggcaaatgcttgctagcgcagtgggtaaaaaagtggtggtaaatacccagctagaa
tccacattagtgggcgtagctggtttagctttcgcgcagttggggcagtctattaccgtt
gatgactcacaaacctcgactgtttactcgccaatattttgcgatgagctggaagagcgc
tatcaaaccttcaaacactatttagataattactag

DBGET integrated database retrieval system