KEGG   Saccharophagus degradans: Sde_1590Help
Entry
Sde_1590          CDS       T00335                                 

Definition
Cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
sde  Saccharophagus degradans
Brite
Enzymes [BR:sde01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Sde_1590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2044263..2045459
Genome map
AA seq 398 aa AA seqDB search
MINRLPLPLAKYYVVFGLGMLLVCLVIAFSFACLRSEPTPYVWHLPPGFPEPPVPPDNPM
TVEKVELGRHLFYEKQLSGNGLQSCASCHQQELAFTDGVAMPVGSTGQVVNRNSMSLVNV
AYSSHFTWAHNGLANLEQQILIPLFNEQPVEMGLTGAQERVLAALASDKQYQALFAKAFP
EAKSITMDNVVKALACFVRSIVSFRSAFDRYAYYGDDSALSEQALEGLALFMSERLECRH
CHSGFNFADTSQHASEKGEPDAFHVTGLYYPLGSSLQPQLQSVLAGIEVDRGLYHVSGVE
TDKDRFRAPSLRNIAVTAPYMHDGSIQSLEEVLDFYSSAGRPAIYDGFGDGRLHPHKSLF
IKGFSLTEAEKAALMAFFLSLTDNDVLSEARWSQPRND
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgattaatcgccttcctctacctttagctaagtattacgtggtttttgggctgggcatg
ctcttggtatgtttagttattgctttttcttttgcttgcttgcgctcagagcctaccccc
tacgtatggcatttacctccggggtttcctgagcctcctgtcccaccagataaccccatg
acggtggaaaaagtagagctggggcgtcaccttttttacgaaaagcagctatcaggtaac
ggtttgcaatcctgcgcgagttgccatcagcaggaattagccttcaccgacggtgtagct
atgcctgtagggtctactgggcaagtggttaaccgcaacagtatgtccttagtgaatgtg
gcctacagcagccactttacgtgggcgcacaacggcttggctaacctcgaacagcagatt
cttataccgttatttaacgagcagccggtggagatggggctcacgggcgcgcaggagcgt
gtgttggccgctttggcatctgataagcaataccaagccctattcgcaaaggcatttcca
gaagcaaaaagcataacaatggataacgtggttaaagcgttggcctgctttgtgcgctcg
attgtatcttttcggtctgctttcgatcgctatgcgtactacggtgacgatagcgcgcta
tctgagcaagcgcttgaggggttggctctgtttatgtcagagcggctagagtgccgccac
tgtcactctgggtttaactttgcagatacttcacaacacgccagtgaaaagggggagccg
gacgcttttcacgtgacggggttgtattatccattaggttcatctttacagccgcaattg
caatctgttttagctgggattgaagtggatagggggctatatcatgtgagtggtgtagag
accgataaagaccgctttagagcgccttcattgcgtaatatagcggttacagccccttat
atgcacgacggcagtattcagagtttggaagaagttttggacttttacagcagtgctggt
agacccgcaatttatgacgggtttggtgatggccgactacacccgcataagagtttgttt
attaaggggttttcgttaactgaagccgaaaaagcagcattgatggcgttttttttatcc
ttgacggataacgacgtgttaagcgaagctaggtggtcgcagcctagaaacgactaa

DBGET integrated database retrieval system