KEGG   Saccharophagus degradans: Sde_1593Help
Entry
Sde_1593          CDS       T00335                                 

Gene name
agl27A
Definition
putative a-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
sde  Saccharophagus degradans
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sde00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Sde_1593 (agl27A)
  Lipid metabolism
   00561 Glycerolipid metabolism
    Sde_1593 (agl27A)
   00600 Sphingolipid metabolism
    Sde_1593 (agl27A)
Enzymes [BR:sde01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Sde_1593 (agl27A)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2048836..2050062
Genome map
AA seq 408 aa AA seqDB search
MQKITRLAALVVAGLCLLGTQAQAKKFEHLAQTPPMGWNSWNNFGCDVDEKLIKETADYM
VSSGMKDAGYEYVNIDDCWHGERDANGFIQADPERFPSGIKALADYVHSKGLKFGIYSDA
GWTTCGGKPGSRGYEFQDAQMYAKWGVDYLKYDWCATDGLKAEGAYQTMREAIHKAGRPM
VFSICEWGDNQPWEWAKPIGHLWRTTGDIYNCFDCEYDHGTWSSWGVLQILDMQDDLRQY
AGPGHWNDPDMMEVGNGMTEAEDRSHFSMWAMLAAPLIAGNDIRNMSEATRKILTNKAVI
AVDQDELGVQGFKYSSKNGVEVWFKPLANDEWAMAVLNRNKGEVKFEFKWRNEVVKDELT
HRTITFNEQKFDWQDLWNKSNKGHTKKFLKTKIAGHDTLMFRLTPAKN
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaattacacgtttagcggcgttagtcgtcgctggcttgtgcctgctaggtacg
caggcgcaggcgaaaaagtttgaacacttagcccaaaccccgcctatggggtggaatagc
tggaacaattttggctgtgatgtagatgaaaagctcatcaaggaaacggctgattatatg
gtttcttccggcatgaaagacgcgggatatgagtatgtaaacatagacgattgctggcat
ggtgagcgcgatgctaatggttttattcaggcagaccccgagcggtttccttccggtatt
aaagcgcttgccgactatgttcattcgaaggggctgaagtttggtatttattctgacgcg
ggttggaccacctgcggcggtaaaccgggcagtcgtgggtacgagtttcaagatgcacaa
atgtatgcgaaatggggcgtggattatcttaaatacgattggtgcgctacagatggctta
aaggccgaaggcgcatatcaaacaatgcgtgaagccattcataaagccggtagaccaatg
gtatttagcatttgcgagtggggcgacaaccagccttgggagtgggccaaacctattggg
catctatggcgtaccacgggtgatatctacaactgtttcgattgcgaatatgaccacggt
acttggtcttcctggggtgtattgcaaattttggatatgcaagacgacctaaggcagtac
gctgggccaggccattggaacgaccccgatatgatggaggtgggcaatggcatgactgaa
gctgaagaccgttcgcatttttcaatgtgggctatgttggcagcgccccttattgctggt
aacgatatacgcaatatgtcggaagctaccagaaaaattctcaccaataaggccgtgata
gcagtcgatcaggacgagctaggcgtacagggctttaaatattccagtaaaaatggcgta
gaggtttggtttaaaccgttggcgaatgatgagtgggcaatggctgtactcaaccgaaat
aaaggtgaagttaaattcgagtttaagtggcgtaatgaagtggttaaagatgagctgacg
catcgcactattacgttcaacgagcaaaaatttgactggcaagatttgtggaataaatcc
aacaagggccataccaaaaaattcctaaaaacaaaaatagctgggcacgatacgctgatg
tttaggctaacgccggctaaaaactag

DBGET integrated database retrieval system