KEGG   Saccharophagus degradans: Sde_1663Help
Entry
Sde_1663          CDS       T00335                                 

Definition
Pyridoxal phosphate-dependent deaminase (EC:3.5.99.7)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
sde  Saccharophagus degradans
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:sde00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Sde_1663
Enzymes [BR:sde01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     Sde_1663
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2130657..2131667
Genome map
AA seq 336 aa AA seqDB search
MPMTTYRPAKTSLANLPTALQPLDRVSQILGGPRIWLKRDDLTGSTLSGNKVRKLEYVVA
EALSNGADTLITCGGLQSNHCRATALVAAQLGLKAHLILRGQQKGSAADGNLLLDDLAGA
QISQYSVADYSKNLTSLFSHWQNHYAQQGRKAWCIPTGASDEIGIWGYIDAFAELEAQLA
ERDINPDLVVCATGSGGTQAGLSLGAHILGSKAKVVGMAVCDSEAYFERKAKQDITLWQQ
KYGQAAGISAQQATQVQINTIDKYIGPGYAKAYPELLERIRWLAATEGVVLDPVYTGKAF
YGLVQEIKSGRWANMKDIVFVHTGGIFGLFPYRDEF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcctatgacaacttatcgacctgccaaaacttcacttgctaaccttcctacagcgctc
cagccattagatcgtgtttctcaaattttgggcggcccgcgtatttggcttaaaagagat
gatctaacgggctctacgttaagcggcaacaaggtgcgtaaattagagtacgtggtggct
gaggcgctctcaaacggcgcagatacgctaatcacttgcggcgggctgcaatctaaccat
tgtagagctacggcgctggtggcggctcaactcggtttaaaggcccaccttatattgcgc
ggccaacaaaagggcagtgctgccgatggcaacctactgctagatgaccttgcaggtgct
cagatatctcaatattcagttgcagactattccaaaaatctaacatcgttattctcccat
tggcagaaccattacgcgcagcaggggcgcaaggcgtggtgtattcctactggggcaagc
gatgaaataggtatttgggggtatattgatgcgtttgctgagctagaagctcagttggca
gagcgagatattaaccctgatttggtggtatgcgccacaggttcgggcgggacacaggct
ggattaagtttaggggcccacatattggggagtaaagcaaaggttgtgggtatggctgtg
tgcgactcagaggcttactttgagcgcaaagctaaacaagatataaccctgtggcagcaa
aagtacgggcaggcagctggaatatctgctcagcaagctactcaggtacaaataaatact
atcgataaatatattggcccaggatatgcaaaagcctaccctgagttgctggagcgtatt
cgctggttggcagccaccgaaggggtggtgctagaccccgtttacacaggcaaagcattt
tatgggttggtgcaagaaattaaatcggggcgctgggcaaatatgaaagacattgtattt
gtacacactggggggatttttggccttttcccctatagagatgaattttag

DBGET integrated database retrieval system