KEGG   Saccharophagus degradans: Sde_1790Help
Entry
Sde_1790          CDS       T00335                                 

Gene name
hex3C
Definition
beta-N-acetylhexosaminidase. Glycosyl Hydrolase family 3. (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sde  Saccharophagus degradans
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sde00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Sde_1790 (hex3C)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Sde_1790 (hex3C)
Enzymes [BR:sde01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Sde_1790 (hex3C)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2281377..2282411
Genome map
AA seq 344 aa AA seqDB search
MLETNNQLLGPVIADIAGQTLSDEDIALIKNPLIGGLILFTRNYSTPSQLDALVKQIRSV
RADIILAVDHEGGRVQRFREGFTRIPAMQVFASAYKARAELTLALACNTGWLMASELRAY
DIDISFAPVLDVDDSFSSIIGDRAFSSDPKAVTALAGAFIDGMQQAGMACTGKHFPGHGS
VRADSHLELPVDYRSLEAIEQLDLMPFAKLQSKLDAVMPAHILFPEVDDQPVGFSSVWLQ
KILRDKMAYDGVIFSDDLTMEGAAVAGSFGERAIKAMSAGCDTLLVCNNREATLEVIQTL
ADNGNYSTSIRLTRMRGKAGAQPIYDLHNNKRWQETKEALLALA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgttggagactaacaatcaattgcttggtccagttattgcggatattgccggtcaaact
ctttccgatgaagatatagcgctaataaagaacccgctaattggcgggttaatactgttt
acccgtaactattcaaccccttcacagcttgacgcgctagttaagcaaattcgcagtgta
cgggcagatataattcttgctgttgaccacgagggtggcagggtgcagcgctttcgggaa
ggctttacccgcattccagctatgcaagtatttgccagcgcttataaagctcgtgccgag
ttaacccttgcgcttgcctgtaataccggctggttaatggctagtgaacttcgcgcttac
gacatagatattagctttgcaccagtattggatgtggatgatagttttagcagcattatt
ggcgatagagctttttcttcagaccccaaagctgttactgcgctagcgggtgcatttata
gacggtatgcaacaagcaggtatggcttgtaccggtaagcattttcctgggcatggcagt
gtgcgtgccgatagccatttagagctgccagtggattatcgctcgctcgaagctatagag
cagctcgatttaatgccttttgctaagttgcaaagtaagcttgatgctgtaatgcctgcc
catatattgttcccagaggttgacgatcagcccgttggcttttcttctgtttggctgcaa
aaaatattgcgcgataaaatggcctacgacggtgtaatttttagtgatgatttgacgatg
gaaggtgccgccgtggcgggtagcttcggggagcgagccataaaagcaatgagcgctggc
tgcgacacattattggtttgcaacaatcgcgaggccacccttgaggttattcagacattg
gcagataacggcaactattctacctctattcgattgaccagaatgcgggggaaagcaggg
gcgcaacctatttatgatttacacaataataaacgctggcaagaaaccaaagaagcatta
ctagcacttgcttaa

DBGET integrated database retrieval system