KEGG   Saccharophagus degradans: Sde_2078Help
Entry
Sde_2078          CDS       T00335                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sde  Saccharophagus degradans
Pathway
sde00260  Glycine, serine and threonine metabolism
sde00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sde01100  Metabolic pathways
sde01110  Biosynthesis of secondary metabolites
sde01130  Biosynthesis of antibiotics
sde01230  Biosynthesis of amino acids
Module
sde_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sde00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sde_2078
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sde_2078
Enzymes [BR:sde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sde_2078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth Peripla_BP_6 IMPDH DUF561 PI-PLC-X
Motif
Other DBs
NCBI-ProteinID: ABD81338
JGI: Sde2078
UniProt: Q21IZ1
Position
complement(2658314..2659126)
Genome map
AA seq 270 aa AA seqDB search
MNRLKKTLSDLKAAQKKALVTYFVNGDPRPSVSLKAMHALVEGGADIIEVGVPFSDPMAE
GPVIQRGHERALEHNVSLKGTLALVKEFRKANSDTPVVLMGYANPVERMGYELFAAQAKA
AGVDGLLTVDLPPEEAVELNKELVANGLESIFLLAPTTTEERMKKVVGLASGFLYYVSLK
GVTGAGHLDVNAVKERVEKISSLTDLPVLVGFGIKDPESAKSIGANADGVVVGSVLVDAM
GNAASESDEVICEKIINIVAPIRAGLDSLA
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcgtttaaagaaaactttgtcagatttgaaagctgcgcaaaagaaggcgttggta
acatattttgtaaatggtgacccacggccgagcgttagtttaaaggctatgcacgcactt
gttgaaggtggtgcggatattattgaggtcggtgtacctttttccgaccctatggccgaa
ggaccagtgattcagcgcggacacgaacgtgcgctagagcacaatgtaagcttaaaaggc
accttggcgcttgttaaagaatttcgcaaagccaacagcgatacgcccgtggtgctaatg
ggctacgcaaaccctgtagagcgtatgggctatgaattgtttgctgcgcaagctaaggcc
gcgggtgtagacggcttgctaacagttgatttgccgccagaagaagccgttgagttaaat
aaagagttggttgcaaacggcctagaaagtattttcctgttggcgccaacaactaccgaa
gaaagaatgaaaaaagtcgttggtttggccagcggcttcttgtactacgtttcattaaaa
ggtgtaaccggagcagggcacctagacgtaaatgcagtaaaagagcgtgttgaaaaaatt
tcatctttaactgacctgcctgttcttgttgggtttggtattaaagaccctgaatctgca
aaaagcattggagcgaatgctgatggcgttgtagttggtagcgtgctcgtagacgctatg
ggcaatgctgctagtgaaagcgacgaggttatttgcgaaaaaattattaatattgtggcg
ccaattagagccggcttagactcattggcttaa

DBGET integrated database retrieval system