KEGG   Saccharophagus degradans: Sde_2079Help
Entry
Sde_2079          CDS       T00335                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sde  Saccharophagus degradans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sde00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sde_2079
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sde_2079
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sde_2079
Enzymes [BR:sde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sde_2079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2659213..2660424)
Genome map
AA seq 403 aa AA seqDB search
MSSKVDYSAVPDVNGHFGPYGGRFVSETLMHALDELEEIYTRVKNDPSFQDEFDQDLAHY
VGRPSPLYFAKRWTDKVGGAKLYLKREDLNHTGAHKVNNTIGQALLAKYTGKTRVIAETG
AGQHGVATATVAARLGLECVVYMGAEDVQRQALNVYRMKLLGAKVVPVTSGSRTLKDAMN
EAMRDWVTNVDNTFYIIGTVAGPHPYPQLVRDFQCVIGREARKQCLEQTGNLPDALVACV
GGGSNAIGLFHPFLEDETVKMYGVEAGGDGVETGRHAAPLNDGIPGILHGNRTYLMEDEN
GQIIETHSISAGLDYPGVGPEHSWLKDIGRVDYVPINDDEAMAAFRNLTLVEGIMPALES
SHAIAYAEKLAKTMSEDKVIIVNLSGRGDKDILTVAKMDGISV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagtaaggtcgattatagtgctgtacctgatgtaaacgggcactttggcccctac
ggtggtcgatttgtttccgaaaccttgatgcatgcgttggatgagcttgaagaaatatac
acgcgtgttaaaaacgaccccagcttccaagacgagtttgatcaagatttagctcattat
gttggtcgaccatcgcctttatacttcgccaagcgctggacagacaaagtgggcggtgca
aagctttatttaaagcgcgaagatttgaaccacaccggcgctcacaaagtaaacaatact
attggccaagcactattagccaagtatacgggtaaaacccgtgttattgctgaaaccggc
gctggccaacacggcgttgcgaccgccactgttgctgcgcgcttaggtttagagtgtgtg
gtttatatgggtgccgaagatgttcagcggcaagcgttgaatgtataccgcatgaaatta
ctcggcgctaaggttgtgccggtaacctctggttcgcggaccttaaaagatgccatgaac
gaagccatgcgtgattgggtaactaacgtcgataatactttttatattatcggtactgtt
gctggccctcatccttacccgcagttagtgcgtgattttcagtgtgtaattggccgcgag
gctagaaagcaatgcttagagcaaacaggtaatttgccagatgccttggtagcttgtgtt
ggcggtggctcgaatgcgattggtttattccacccattcttagaagatgaaactgtaaaa
atgtacggcgtagaagctggtggtgatggcgtagaaactggtcgccacgctgcaccatta
aatgacggtattccgggtatcttacacggtaatcgcacctacctaatggaagatgagaac
gggcaaataattgaaacccattcaatttctgctggtttagattaccctggtgttggccca
gagcattcatggttaaaagacataggccgcgtagattatgtgcctattaatgacgatgaa
gccatggcggcttttagaaacttaactctcgttgagggtattatgcctgcgctagagtct
agtcatgctattgcctacgcagaaaaactagccaaaaccatgagcgaagacaaagtgata
attgttaatctgtctggtcgtggagataaagacattcttactgtcgcaaaaatggatggc
attagcgtttaa

DBGET integrated database retrieval system