KEGG   Saccharophagus degradans: Sde_2103Help
Entry
Sde_2103          CDS       T00335                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sde  Saccharophagus degradans
Pathway
sde00020  Citrate cycle (TCA cycle)
sde00640  Propanoate metabolism
sde00660  C5-Branched dibasic acid metabolism
sde01100  Metabolic pathways
sde01110  Biosynthesis of secondary metabolites
sde01120  Microbial metabolism in diverse environments
sde01130  Biosynthesis of antibiotics
sde01200  Carbon metabolism
Module
sde_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sde_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sde00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sde_2103
   00640 Propanoate metabolism
    Sde_2103
   00660 C5-Branched dibasic acid metabolism
    Sde_2103
Enzymes [BR:sde01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Sde_2103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ABD81363
JGI: Sde2103
UniProt: Q21IW6
Position
complement(2686539..2687705)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQGKQLFAEYGLPVSKGIAAETPAEAAAAADIIGGDKWVVKAQVHAGGRGKAGGV
KLVSSKAEIEEFAKKWLGNNLITYQTDENGQPVSRILVESCTDIADELYLGAVVDRSTRR
VIFMASTEGGVEIEKVAEETPEKILKAIIDPLTGAQPYQARELGFKLGLNPVQIKQFTQI
FLGLAKMFVDKDLALLEINPLVITDEGNLHCLDAKVAIDGNAMYRQPALKEMHDPSQEDE
REAHAAKWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGQPANFLDVGGGATKERVVE
AFKIILSDDNVKAVLINIFGGIVRCDLIAEGVIGAVEEVGVKVPVVVRLEGNNAELGAKV
LADSGLNIIAAESLTDAAVQVVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacatgaatatcaaggcaaacagctttttgctgaatatggtttgccagtatct
aaaggcatagctgcagaaactcctgcagaagcggcagcagctgcagacattattggtggt
gataagtgggttgttaaagctcaggttcacgctggtggtcgcggtaaagcgggcggcgtt
aaattggtttctagcaaagcagaaatcgaagagttcgctaaaaagtggttaggtaataac
ttaattacttatcaaacagatgaaaatggtcagccagttagccgtattttggttgaaagc
tgcaccgatatcgctgacgaattgtacttgggtgcagttgtagaccgttctactcgtcgc
gtaatttttatggcgtctactgaaggcggcgtagagattgaaaaagttgctgaagaaact
ccagaaaaaatcttaaaagcgattatcgatcctttgactggcgcacagccatatcaagct
cgcgaattaggttttaaattgggcttaaacccagttcaaatcaagcaattcacccaaatc
tttttaggtttggcgaaaatgtttgttgataaagacttggctcttttagaaatcaaccca
ttggttattactgatgaaggtaacttgcactgcctagacgctaaagtagctatcgacggc
aacgcaatgtaccgtcagcctgcgcttaaagaaatgcacgatccttcacaagaagacgag
cgtgaagcgcatgcagctaaatgggaacttaactacgtagcactagatggcaacatcggc
tgtatggttaacggtgctggtttggcaatgggtactatggatatcgtgaaattacacggt
ggccaacctgcaaacttcctagacgtaggcggcggcgcaactaaagagcgcgttgttgaa
gcattcaaaattattctttctgacgacaacgtaaaagctgttttaattaacatctttggc
ggtattgttcgttgtgacctgattgcagaaggtgtaatcggcgcagtggaagaggttggt
gttaaggttcctgttgttgttcgtttagaaggtaacaacgcagaattgggtgcaaaagtg
ttggcagatagtggcctaaacattattgctgcagaaagcttaactgatgctgcagtacaa
gttgttaaagctgcggagggcaaataa

DBGET integrated database retrieval system