KEGG   Saccharophagus degradans: Sde_2105Help
Entry
Sde_2105          CDS       T00335                                 

Definition
2-oxoglutarate dehydrogenase E2 component (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sde  Saccharophagus degradans
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sde_2105
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sde_2105
  Amino acid metabolism
   00310 Lysine degradation
    Sde_2105
Enzymes [BR:sde01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Sde_2105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2689457..2690668)
Genome map
AA seq 403 aa AA seqDB search
MTIEIKAPTFPESVQDGTVATWHKQPGEACSRDELIVDIETDKVVLEVVAPADGSIAEII
KGEGEIILSGEVIAKFVAGAAGSAPAPAAAEAAPAASEASEDVIAAPAARKLAAEKGIDL
ALVKGTGKDGRITKEDVAGYKPAAAAAPAPAAAPKAAAPASTGAVAPTGLREEKRVPMTR
LRARIAERLLDANNNTAMLTTFNEVNMAPVMNLRKQYKDLFEKTHNGSRLGFMGFFVKAA
VEALRRFPAVNASIDGNDMVYHGYQDVGCAVSTDKGLVVPVLRNAENLSIAEIENGIRDF
GLRARDGKLGIEEMTGGTFTITNGGVFGSLLSTPILNPPQAAILGMHKIQERPMAVNGEV
KVLPMMYLALSYDHRIIDGKEAVQFLVTIKDLLEDPARMLLEV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaccatagaaattaaagcacccacttttccggagtctgttcaagacggtactgtggca
acttggcacaagcagccaggtgaagcctgttcacgtgatgagcttattgttgatattgaa
actgataaggtggtgctcgaagtagttgcaccggctgacggttctatcgctgaaatcatt
aaaggtgaaggcgaaattattttaagcggtgaagttatcgctaaattcgtagctggcgct
gcaggttctgcgcctgctccagctgctgccgaagccgctccagctgctagcgaagcatct
gaagacgttattgctgcacctgctgcgcgtaaactcgctgcagaaaagggcatcgattta
gcgttagtgaagggcactggtaaagatggccgtatcactaaagaagacgtagctggttac
aagcctgccgctgctgcagcacctgcaccagctgccgcgccaaaagctgctgctcctgca
tctaccggcgctgtagcgccaactggtttgcgtgaagaaaagcgtgtaccaatgactcgt
ttgcgtgcacgtattgcagagcgtttgttggatgccaataacaataccgcaatgttgact
acgtttaacgaagtgaatatggcgcctgttatgaatctgcgtaaacaatacaaagatttg
tttgagaaaacccacaacggttcacgtttaggcttcatgggctttttcgtaaaagctgct
gttgaagcattgcgtcgtttccctgctgttaacgcatcaatcgacggtaacgacatggtt
taccacggttatcaagatgtgggttgtgcagtgtctaccgataaaggtttggttgtacct
gttttgcgcaacgcagaaaacttgagcattgctgaaatcgaaaacggtattcgcgatttc
ggtttgcgtgctcgcgatggtaagttgggtattgaagaaatgaccggtggtactttcact
attactaacggtggtgttttcggttctttactttcaacgcctatcttgaacccaccacaa
gcggcaattttgggtatgcacaaaatccaagagcgcccaatggctgttaacggtgaagtg
aaagtgttgccaatgatgtacttggcgctttcttacgatcaccggatcattgacggtaaa
gaagcggttcagttcttggttaccattaaggacctgctagaagaccctgcacgtatgttg
ttagaggtttaa

DBGET integrated database retrieval system