KEGG   Saccharophagus degradans: Sde_2109Help
Entry
Sde_2109          CDS       T00335                                 

Definition
succinate dehydrogenase subunit D (EC:1.3.5.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
sde  Saccharophagus degradans
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sde_2109
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sde_2109
   00650 Butanoate metabolism
    Sde_2109
  Energy metabolism
   00190 Oxidative phosphorylation
    Sde_2109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2696325..2696693)
Genome map
AA seq 122 aa AA seqDB search
MVTAVTSFGRSGLSDWVAQRFSAVVLAAYTIFIVAYLVMHPGLTYEEWSGLFQQLWVRIF
TLLVLISIAAHGWIGLWGVLTDYITTRMIGSSALFLRTVALSVYAIITFAYLVWGVQILW
GF
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggtaactgccgtaacaagttttggtcgcagtggtttatccgattgggttgcacagcgc
ttttcagcagtagttttagctgcttacactatttttattgttgcctatttggtgatgcac
cctggtttgacctatgaagaatggtctgggttgtttcagcagttatgggtgcgcatcttt
actttattggtgcttatttcaattgctgcacacggctggattggcctgtggggcgtatta
actgattatattactactcgaatgattggctcgtctgcgttatttcttcgcactgtggcg
ttgtctgtttacgcaattattacgttcgcctatttggtttggggcgttcaaattctgtgg
ggattttaa

DBGET integrated database retrieval system