KEGG   Saccharophagus degradans: Sde_2160Help
Entry
Sde_2160          CDS       T00335                                 

Definition
Protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
sde  Saccharophagus degradans
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:sde00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Sde_2160
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Sde_2160
Enzymes [BR:sde01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Sde_2160
Two-component system [BR:sde02022]
 CheA family
  CheA-CheYBV
   Sde_2160
Bacterial motility proteins [BR:sde02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Sde_2160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2752142..2753239)
Genome map
AA seq 365 aa AA seqDB search
MAYKVLVVDDSQFFQVRLKQIINEHPDLEVVGIAANGQEAIDLEESLRPDIISMDYEMPH
LDGISAVRSILSKRPIPIVMFSSMTYEGATITLEALDAGAVDFIPKNFAEVSRDSVVLKK
RLHEKLLLFAQKAKPSVAARSTTQPSGVRPSALGANLSSSRSPRPASSAPSAPKKRIKGL
VKLVAIGASTGGPVAVSEIITRLPANFPVPVIVAQHMPENFTKAFSERLNRQSAVEVREA
QDGDLLKSGVVYVAPGGNQLMVDKTGRSIRILDGDARLTYKPSVDVLFASAASAMGDKVL
AIVLTGMGADGCDGAKLLKQKGATIWGQDKDSCVVYGMPAAVAKAGLTDEVLPLDQVWQR
LVSDV
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
gtggcttataaagttctggttgtagacgattcacaattttttcaggtgagattaaagcaa
ataattaatgagcatcctgatttagaagttgttggcatcgcagctaatggccaagaagct
attgacctagaagagtcattgcgccccgatatcatatctatggattatgaaatgccacat
cttgatggtatttctgctgtgcgctcgatcttgtccaagcggcctatacccatcgttatg
ttttcatctatgacatacgaaggggccacaattacgttagaagctttagatgctggggca
gtggattttattcctaaaaacttcgctgaagtatcccgcgattcagtcgttttaaaaaag
cgcttgcacgaaaagctattgttgtttgcacaaaaagctaagccgagtgtggcggcacgc
agtacaacccagccaagcggggttaggccctctgccttaggtgcaaatctgtcttccagt
cgctcacccaggccggctagtagtgcacccagtgcccctaaaaagcgaataaaaggctta
gttaaattagtagcaattggcgcgtctaccggtgggcctgttgccgtttcagaaataatc
actcgtttgccagccaactttcccgtgccagtcattgtggcgcaacacatgccagaaaac
tttaccaaagcattctcagagcgccttaatcggcagtcggctgtagaggtaagagaagcg
caagatggcgatttacttaagtccggtgtggtatatgtggcgcctggcggcaaccaatta
atggtcgataaaactggtcgctccatacgtattcttgatggcgatgcgcgcttaacctac
aagccttcggtcgatgtgttgtttgcgtctgctgcaagtgccatgggcgataaagtgttg
gcaatagtattaacggggatgggcgcagatggatgcgatggcgctaagttattaaaacaa
aaaggcgcaaccatatggggccaggataaagactcctgtgttgtatatggtatgccagcg
gctgtagccaaggctggactaacagatgaagttttaccgttagatcaagtgtggcaacgg
ctggtttcggatgtttag

DBGET integrated database retrieval system