KEGG   Saccharophagus degradans: Sde_2385Help
Entry
Sde_2385          CDS       T00335                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
sde  Saccharophagus degradans
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sde00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Sde_2385
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sde_2385
Enzymes [BR:sde01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Sde_2385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3024820..3025833)
Genome map
AA seq 337 aa AA seqDB search
MKFSGSHILSVEQFERADIERIFAVADSMEPYALRQKVTRVLEGAILGNMFFEPSTRTRV
SFGCAFNLLGGEVRETTGFKSSAIAKGESLYDTARVLSGYSDVICMRHPQEGSVAEFAQA
SRVPVINGGDGANEHPSQALLDLYTIQKELRDKGRSLDGLRIAMIGDLKHGRTVHSLMRL
LGLFANLQVVLVSPEELAMPEEYVELLRGLGHRVDVSSDLANSIGHVDIVYSTRIQEERF
GSKEEADLYRGRFRLNQAIYTQFCEPNTVIMHPLPRDSRSDANELDNDLNQNPNLAIFRQ
TDNGILVRMALFALILDVADQVDKFSRPVNWYHSRTF
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttctggttctcacatcttatcggtagagcaattcgaacgcgcagatatagag
cgtatttttgccgttgctgattccatggagccttatgccctgcgtcaaaaggttacccgc
gtgttagagggtgccattttgggcaatatgtttttcgagccctctacgcgtacccgggta
agttttggttgtgctttcaacctgttgggcggggaggtaagagagaccacaggttttaaa
agttctgccatagcaaaaggcgagtcgctttacgataccgcgcgtgtactgtctggttac
tccgatgtaatttgcatgcgtcacccgcaagaagggtctgtagctgaatttgcccaagcg
agtagggtgcctgtaattaacggtggcgatggtgccaatgagcacccaagccaagcgctg
ctcgacctatacaccattcaaaaagagctgcgcgataaaggccgcagtttagatggtttg
cgtatcgccatgattggcgacttgaagcacggtcgtaccgttcactctttaatgcgctta
ttggggttgtttgcaaatttgcaggtagtgttagttagcccagaagagctcgccatgcca
gaagagtacgtagaattgctgcgcggcttggggcacagagtggatgtatcgtccgatttg
gccaacagtattggccatgttgatattgtgtattctactcgtatccaagaggagcgcttc
ggctcgaaagaggaggccgacttgtaccgtggtcgattccgcttaaaccaagctatttac
acccagttttgcgagccaaacacggtaattatgcacccgctgccacgcgattctcgctcc
gatgcgaatgagttagataacgacttaaaccaaaaccccaacctggcaattttccgccaa
accgataacggtattttggtgcgaatggcgctgtttgcattaattttggatgttgctgat
caagtagataaattctcgcgaccagtaaactggtaccacagccgcacattttag

DBGET integrated database retrieval system