KEGG   Saccharophagus degradans: Sde_2490Help
Entry
Sde_2490          CDS       T00335                                 

Gene name
cel5B
Definition
endoglucanase-like protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
sde  Saccharophagus degradans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sde00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sde_2490 (cel5B)
Enzymes [BR:sde01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Sde_2490 (cel5B)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3145429..3147129)
Genome map
AA seq 566 aa AA seqDB search
MFLLDFTRTAFSCTRKLTFLKSALLISCFAGLTACGGGSDGGAASGSSSSSSSSSSSSSS
SSSSSTSSSSSSSSSSSSSSSSSSNSSSSSSGGDALACQHEMAPALLSASDTTMVQAEYY
DTCASSALDNTTGNSGGELRTDDVDIVAIADGYAITDMQSGEYVEYSLTVQTSGLFDISF
AVQPHAANTAGLALSVDGAVLGTVDIAANDSTAFGEYTLNGVYISDGAQVIRVTMAGEGA
AIGLDSIAFNYTDNTVYTPENAVLGMGIGINLGNTLDAFPNEGDWAPAAQEYYFKAYKDA
GFRHVRIPATWDDHTADTAPYAVNAARMDRTEQIVDWALAQGYFVILNAHHEHWLKENYG
NQTYRDRFDAIWQQIAERFKNKSARLMFEILNEPNGMTVADVDDLNPRILDIIRETNPTR
LVVFSGNGYTPVDALLAAAIPNDDYLIGNFHSYDPWQFGGQCVRSWGTEQDYTDLENIYK
RANTWSEQHDIPVMVNEFGAAHYDFTAPQNVCNQQARLAYLGAHATFAIQYGFGASVWDD
GGSFEVYKRGENSWREAKDVLVAPNP
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttttagactttacccgcactgcgtttagctgtacacgaaagcttacctttttg
aaatccgcgctacttataagctgctttgccgggcttactgcctgtggtggcgggagtgat
ggcggtgctgcaagtggctcatcctctagctcgtctagcagcagttcgtctagtagctct
tcgagcagttcttcaactagttcctcaagctcctcttcaagctctagttcgtccagttcc
agctcttcgtctaatagttcctctagctcctctggtggcgatgctttagcgtgccagcat
gaaatggcaccagcgctattatctgcaagtgatactaccatggtgcaagcggagtattac
gatacctgtgcttcttcggcattagataacaccactggtaacagtggcggtgagttgcga
actgacgatgtagatatagtggccattgcggacggctatgctattacggatatgcagtca
ggcgagtacgtagaatattcactaacagtgcaaacttccggtttgtttgacattagtttt
gcggtacagccgcacgcagctaatactgccggtttggcgctgagtgtagatggcgcagtg
ttaggcacagttgatattgccgctaatgacagcaccgcatttggcgaatatacgcttaac
ggcgtgtacataagcgatggcgcgcaagtaataagggtaaccatggccggcgaaggcgct
gctattgggttagattccattgcctttaattacaccgataataccgtttacaccccagaa
aacgccgtgttgggtatgggaataggtattaacctaggcaataccttagatgccttcccc
aacgaaggtgactgggcaccggctgcgcaggaatactattttaaagcctacaaggatgca
ggtttccgccatgtacgcatcccagcaacttgggatgatcacacggctgatacagccccc
tacgctgtaaatgcagcacgtatggatcgcactgagcagattgtagattgggccttggcg
cagggctatttcgtaattcttaatgcccaccacgaacactggctaaaagaaaactacggc
aatcaaacataccgcgatcgctttgatgcaatttggcagcaaattgccgaacgctttaag
aataagtcggctcgcttaatgtttgagatactcaatgagccaaacggcatgacagtggcc
gatgtggatgacctcaacccacgtattctcgatattattcgcgaaaccaatcccacgcga
ttggtagtgttctctggtaatgggtatacccctgtggatgccttacttgcggctgcaatc
cctaatgatgattaccttattggtaactttcactcctacgacccttggcagtttggcggt
cagtgcgtacgatcgtggggtacagagcaagattacaccgacctagagaacatatataag
cgcgcaaatacttggtctgagcagcacgacatacccgttatggtgaacgaatttggcgct
gcccattacgattttactgcaccgcagaatgtatgtaaccagcaggctcgtttggcttat
ttaggtgcccatgccacatttgctattcagtacggctttggcgcaagtgtatgggacgac
ggtggatcatttgaggtgtacaagcgcggtgaaaatagctggcgcgaagctaaagatgta
ttagtggcgccaaacccgtag

DBGET integrated database retrieval system