KEGG   Saccharophagus degradans: Sde_2504Help
Entry
Sde_2504          CDS       T00335                                 

Definition
D-xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
sde  Saccharophagus degradans
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sde00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sde_2504
   00051 Fructose and mannose metabolism
    Sde_2504
Enzymes [BR:sde01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Sde_2504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3173716..3175047)
Genome map
AA seq 443 aa AA seqDB search
MSVVLGDKEYFPGVGKIEFEGPDSDNPFAFKYYDENRVVAGKTLKEHFKFSVCYWHTFCG
TGADPFGPGPLQFPWNKADTADARARLKMDAAFEFITKLGAPYYCFHDIDLVEEGASRQE
TQRRVQTIVEYAKEKQAASGVKLLWGTANLFSNPRYMNGASTNPDFNVVAYAGAQLKDAL
DATIALDGENYVFWGGREGYMSLLNTDMGREQEHLARFLTMARDYARGQGFTGNFFIEPK
PMEPSKHQYDFDSETVIGFLRHHGLDKDFKLNIETNHATLANHTMDHEMTVAANAGMLGS
IDANRGDYQNAWDTDQFPYNINETVEMMMVVLRAGGFQGGGVNFDAKRRRNSTDLEDTFH
GHIGGMDTFARALIIADRIISESKIESMRKERYASFDSGAGKQFETGALDLAALAEIGNA
IGEPALTSGKQEYYENIINQYIR
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtagtacttggcgataaagaatacttccccggtgtgggcaaaattgaatttgaa
ggcccagattccgacaacccatttgcatttaaatattacgatgagaaccgtgtagttgcc
ggcaaaacattaaaagagcactttaagttctctgtatgttactggcacacgttctgcggc
acaggtgctgatccatttggccctggcccattgcaattcccgtggaacaaggccgacacc
gcagacgcgcgcgcgcgtttaaaaatggatgcggcatttgaatttatcaccaagttgggc
gcgccttattactgtttccacgatatcgatttagttgaagagggcgcgagtcgccaagaa
actcaacgccgtgtacaaacgattgttgaatacgcaaaagagaagcaagcggcttctggc
gttaagttgctttggggcaccgctaacttattttccaacccacgttatatgaatggtgca
tctacaaacccagattttaacgttgttgcttatgctggcgcgcagttaaaagatgcactt
gatgcaaccattgcgctagatggtgagaactatgttttttggggtggccgtgaaggctac
atgagccttttaaataccgatatgggcagagagcaagagcatttggctcgctttttaact
atggccagagattacgctcgtggccaaggttttaccggtaatttctttatcgagcctaaa
ccaatggagccttccaagcatcagtacgattttgacagtgaaaccgtaattggtttcttg
cgtcatcacggtttggataaagactttaaattaaatatagaaacaaaccacgccacactt
gctaaccatactatggatcacgaaatgaccgtagcggctaatgcgggcatgctaggtagc
attgatgcaaaccgcggtgattatcaaaatgcttgggataccgaccagttcccttacaac
attaacgaaaccgttgaaatgatgatggtagtgctgcgtgcaggagggttccaaggtggt
ggagtaaactttgatgctaagcgccgtcgtaattctaccgacctagaggataccttccac
ggccatataggcggtatggatactttcgcgcgcgcactaattattgcagacagaattatt
agtgaaagcaaaatcgaaagtatgcgcaaagaacgttatgcttcttttgatagcggcgct
ggtaaacaatttgaaacgggcgctctagatttagctgccctagccgaaataggtaacgcg
attggtgagcctgcattaaccagtggtaagcaggagtactacgagaacattattaaccaa
tatattcgttaa

DBGET integrated database retrieval system