KEGG   Saccharophagus degradans: Sde_2607Help
Entry
Sde_2607          CDS       T00335                                 

Definition
(GenBank) succinyldiaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sde  Saccharophagus degradans
Pathway
sde00300  Lysine biosynthesis
sde01100  Metabolic pathways
sde01120  Microbial metabolism in diverse environments
sde01230  Biosynthesis of amino acids
Module
sde_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:sde00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Sde_2607
Enzymes [BR:sde01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Sde_2607
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer BNR_2 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: ABD81867
JGI: Sde2607
UniProt: Q21HG2
Position
3305833..3306981
Genome map
AA seq 382 aa AA seqDB search
MTNESAHNTPTVKLACDLIAQPSVTPEDAHCQRMMIERLEAIGFKVENLRFGDVDNFWAI
RGESGPILAFAGHTDVVPTGDLGKWATDPFTPTIKDGMLYGRGAADMKGSLAAMITACES
FIAAHPNHTGRIAFLITSDEEGPAINGTVKVVEWLEARNEKIKWCLVGEPSSTTLVGDVI
KNGRRGSLGAELIVKGVQGHVAYPHLAVNPIHMIAPALAEMASETWDNGNEFFPPTSFQV
SNFNSGTGATNVVPGEANVVFNFRFSTELTADILKQRTHAILDKHNVNYDLKWNLSGEPF
LTAEGELVAASVAAIKKITGRDTELSTAGGTSDGRFIAPTGAQVLELGPVNATIHQINEC
VSVDDLNTLSDIYCTMLTELLA
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacgaatccgcacacaacaccccaaccgtaaaattagcctgcgacctcattgca
cagccttctgttaccccagaagatgctcactgccaacgcatgatgattgagcgcttagaa
gccattggttttaaagtagaaaacctgcggtttggtgacgtagataacttttgggcgatt
cgcggcgaaagtgggccgatactcgcctttgctggccacacagatgtagtgcctacaggc
gacttgggcaaatgggccacagacccattcaccccaaccattaaagacggcatgctctac
gggcgcggcgccgccgacatgaaaggcagcctggccgccatgattaccgcatgcgaaagt
tttattgcggcccacccgaaccacacagggcgcattgcgtttttaattaccagtgatgaa
gaaggcccagccattaacggcaccgttaaagtggttgagtggctagaagcgcgcaacgaa
aaaataaaatggtgtttggttggcgagccatcaagcactaccttagtgggcgacgtaatc
aaaaatggtcgccgcggttcactaggtgccgaacttatcgttaaaggcgtgcagggccat
gtggcgtaccctcaccttgcggtaaaccccattcacatgattgcaccggcacttgcagaa
atggcgagtgaaacctgggataacggcaacgaattttttccgcctaccagctttcaggtt
tctaattttaacagcggtaccggcgcaaccaatgtggtaccgggcgaagccaatgtggtg
tttaatttccgcttctctaccgagctaaccgcagacattttaaaacagcgcacccacgcc
atattagataagcacaacgtaaactacgatttaaaatggaatttatctggcgagccgttt
ttaacggccgaaggcgagcttgttgctgcatccgttgccgccattaaaaaaattaccggc
cgcgacacagagctgtctaccgctggcggcacatccgacgggcgctttattgcccctacc
ggcgcacaggtattagagctaggcccagttaacgccactattcatcaaataaacgaatgt
gtaagcgtagatgacctaaataccttaagcgacatctactgcactatgcttacagagtta
ctcgcttaa

DBGET integrated database retrieval system