KEGG   Saccharophagus degradans: Sde_2633Help
Entry
Sde_2633          CDS       T00335                                 

Gene name
xyn10C
Definition
putative xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
sde  Saccharophagus degradans
Brite
Enzymes [BR:sde01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Sde_2633 (xyn10C)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3331475..3332599)
Genome map
AA seq 374 aa AA seqDB search
MNCTRRNIVKAGLLGSAFVALPAVARALPGLATKFRDQFYVGTAVSARSLNTPSGAFAAT
VAHQFNALTAENAMKPALLQPQMGEWRWQDADAIVRFAEQHQMLMHGHTLVWHSQTPDWF
FQNKQGEPADKATLYRRQEEYINAVVGRYKGRVHSWDVVNEAEDEGKGWRKSHWYNICGP
EFMERAFRLAHAADPKAHLCYNDYNMHLPQKREFLVKLFKDYIKRGVPIHGVGLQGHVGL
DYPSLDELEKTIVAMADLGLKVHITELDVDVLPAPWQLASADISTKFEYDKSLNPYVDGL
PDAVNQQLSARYVELFKLFIKHQQHIGRVTFWGVGDGDSWKNNFPVPGRTNYPLLFDRNL
KPKPAYNALVALKL
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtgaattgtacgcgtaggaatatagtaaaagcaggccttcttggctcggcattcgtcgcc
ctgcctgccgtggcgcgcgcgctgcctggattggccacgaaatttcgcgatcagttttac
gtgggcactgcggttagtgcgcgctcacttaatacgcccagcggcgcgtttgcagccact
gtcgcgcatcaattcaatgcactaaccgctgaaaacgccatgaagcccgccttacttcaa
ccacaaatgggggagtggcgctggcaggatgccgatgccattgtgagatttgccgagcag
catcagatgctaatgcatggtcacacccttgtgtggcattcgcaaacgccagattggttc
ttccaaaacaagcagggcgaaccggcagacaaagcaaccctataccgcaggcaagaggag
tatatcaatgccgtagttgggcgctataaagggcgggtacactcgtgggatgtggtgaat
gaagcagaagatgagggtaaaggctggcgcaagagccactggtataacatttgtgggcca
gagtttatggaacgagcctttcgcttagctcacgcagcggacccaaaagcacacttatgt
tacaacgattacaatatgcacttgccgcaaaagcgcgaatttttggttaagttattcaaa
gactacattaagcgcggcgtgcctattcacggcgtagggttgcaggggcatgtgggctta
gactacccctcgctggacgagttggaaaaaaccatcgtggccatggccgatttaggtcta
aaagtacacattacagaattggatgtagatgtattacccgcgccatggcaactagctagc
gcagatataagtactaaattcgagtacgacaaaagcttaaacccgtacgttgatggtttg
cctgacgcggtgaaccagcagcttagtgcgcgttatgtagagctattcaagctgttcatt
aagcatcagcaacatattggacgtgttacgttctggggcgtcggtgacggtgactcgtgg
aaaaataactttccggtaccagggcgaaccaattaccctttgttattcgatcgtaatttg
aaaccaaagcctgcttataacgccttagtggccctcaagttgtaa

DBGET integrated database retrieval system