KEGG   Saccharophagus degradans: Sde_2636Help
Entry
Sde_2636          CDS       T00335                                 

Gene name
cel5D
Definition
endoglucanase-like protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
sde  Saccharophagus degradans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sde00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sde_2636 (cel5D)
Enzymes [BR:sde01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Sde_2636 (cel5D)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3335102..3336967)
Genome map
AA seq 621 aa AA seqDB search
MLKHQFSKALRALGFGGAVFAASLMASQASALECEHSISNDWGAGFTGAMKVTNNDSSPI
TGWRVEWAYSGNVNIVNSWNASVTKGSNYVAVDAGWNGNLQPSQSTEFGLQGDGADRNVT
IISCVAEGGSSSSSSSSSSSSSSSSSSSSTSSSSSSSSSTSSSSSSTSSSSSSTSSSSSS
SSSSSSSGGNCVAMCNWYGENRPVCANQNTGWGWENNQSCIGANTCNDQWGDGGVVSSCG
TSSSSSSSSSSSSTSSSSSSSSSTSSTSSSSSSSSSSGGLSAVEFSQQMGLGWNLGNSLE
AIGGETAWGNPMVTQQLINSIKAAGFDTIRIPVAWSQFSDEANFVINSNWIARVEEVVNY
ALSADMYVVMNQHWDGGWMQPTYAQQEYVNNRLQIMWTQIANHFKDYDSRLLFAGTNEVM
VEGDYGTPTFEYYTVQNSFNQTFVDAVRATGGANASRYLVVQGFNTNIDHTVNFAVVPTD
PATNRLMMEVHYYDPYNFTLNTNSNITQWGVIATDPSVTETWANESYVDATFQKMKTNFV
DQGIAVILGEYGVVSRANVAGHETYREYWNQYITQSAVDHGMVPIYWDNGYSGDGGMALF
DRASGNQLYPNIINAIINAGN
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaacatcaattcagcaaagcgctgcgtgcgctaggctttggtggggctgtgttt
gcggcatcgctaatggctagccaagcaagtgcccttgagtgtgagcattcaatcagtaat
gattggggcgccggctttaccggtgcaatgaaagttaccaataatgactctagccccatt
accggttggcgggtcgaatgggcgtatagcggcaatgtaaatattgttaattcgtggaac
gcctcagtaacaaaaggcagtaattatgttgccgtagatgccggatggaatggtaattta
cagccgagccaatctaccgaatttggcttacagggtgatggcgccgatagaaatgtaacc
attattagttgtgttgccgaaggcggatcatcttctagttcatcaagttcttccagctcc
tcaagtagttcttcatctagctcaagtacttcttcatcgagtagctcaagttcctcgacg
agctcttcttctagttcgacttctagctcttcttcaagcacctcttctagctcatcgtcc
agttcatcaagctcttcttcgggcggcaactgtgttgcaatgtgtaattggtacggtgaa
aaccgccctgtttgtgccaatcaaaatactggttgggggtgggaaaacaaccaaagctgt
ataggtgcaaacacctgtaacgatcaatggggcgacgggggcgtggtgtccagctgtggt
acgtctagctcttcatccagttcttcgtccagttcgtctaccagttcatcctcgtcttct
agctcgagcaccagctctacaagcagctcatcaagctctagttcgtcgtctggtgggtta
agcgcggtagagttttcgcagcaaatgggcttggggtggaatcttggaaactccctagaa
gcgattggtggcgaaaccgcgtggggcaacccaatggttacgcagcaattaattaactcc
ataaaagctgctgggttcgacactattcgcattccggttgcgtggagccaattctcggac
gaagctaattttgttatcaatagcaattggattgcacgcgtagaagaagtagtgaactac
gcattgagcgccgatatgtacgtggtaatgaaccaacattgggacggcggttggatgcag
cccacatatgcacagcaagaatatgttaacaatcgcttgcaaattatgtggacgcaaata
gctaatcactttaaagattacgatagtcgcttactgtttgcaggcaccaacgaagtgatg
gtggaaggcgattacggtacgcccaccttcgaatactacacagtacaaaatagctttaac
caaacgtttgtggatgctgtacgtgcaaccggtggcgctaatgctagccgttacttagtg
gtacaggggtttaataccaacatagatcacacggtgaacttcgcggtagtgccaaccgac
ccggcaacaaacaggttaatgatggaagtacactattacgacccctataactttacgtta
aataccaacagcaacattactcagtggggcgtaattgcaactgaccctagcgttaccgaa
acatgggcgaatgaatcttatgtggatgcgactttccaaaaaatgaaaactaacttcgtt
gatcaaggtatagcggtaattttaggtgagtacggggttgtatcgcgcgcgaatgtggcc
gggcacgaaacttaccgagagtattggaaccaatacattactcaatctgcggtagatcat
ggaatggtgcctatttattgggataacggttattccggtgatggtggtatggcattgttt
gatcgcgccagtggcaatcaactttaccccaatattattaacgcaattatcaatgccggt
aactaa

DBGET integrated database retrieval system