KEGG   Saccharophagus degradans: Sde_2717Help
Entry
Sde_2717          CDS       T00335                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sde  Saccharophagus degradans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:sde01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:sde01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sde00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sde00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:sde00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3444195..3444935)
Genome map
AA seq 246 aa AA seqDB search
MRRRLIVGNWKMCGDFRTNQKRLEDLSSLWFGVHQTEVSVSPAYPYLAQAAGMLENTNIS
LCAQDVSTRENGAFTGEVSAAMLADMGCRYVMVGHSERRHYHNEGYDLIAEKFQAVCEAK
MIPILCLGETTADREADRTFDVIGRQLLKVVNACGLEGLAKGVVAYEPIWAIGTGRAATP
EQAQDVHSYIREILGPEGEQIRILYGGSVKPDTAEGLFAKKDIDGALVGGASLDARDFVA
ICRAAE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaggcgactaattgtaggcaactggaagatgtgcggagattttcgtactaaccag
aagcgccttgaggatttatcttcactttggtttggagttcatcaaacggaagtgagtgtt
agccccgcatacccgtatttggcgcaagccgcaggcatgctggagaacacaaatatatcc
ctgtgtgcgcaggatgtaagcacccgagaaaacggggctttcaccggcgaagttagcgcg
gcaatgttagccgatatggggtgcaggtatgtgatggtggggcacagtgagcgccgtcat
tatcacaacgaaggttacgatttaattgcggaaaagtttcaagccgtttgcgaggctaaa
atgattcccattttgtgcttaggcgagaccacagctgatcgcgaagcagatagaacgttt
gacgttattggtcgccagttgttaaaggtggttaatgcgtgtggcttagaagggttggcg
aaaggtgttgttgcctacgagcctatctgggctatagggacggggcgtgcggctacacca
gagcaagctcaagatgtgcactcctacattagggaaatattggggccagaaggcgaacaa
atccgtattttatacggcggtagcgttaagcctgataccgctgaaggattatttgctaaa
aaagatatcgatggtgcattggtggggggggcttcccttgatgcgcgtgactttgtcgca
atatgtcgagcggcagagtag

DBGET integrated database retrieval system