KEGG   Saccharophagus degradans: Sde_2717Help
Entry
Sde_2717          CDS       T00335                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sde  Saccharophagus degradans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sde_2717
   01230 Biosynthesis of amino acids
    Sde_2717
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sde_2717
   00051 Fructose and mannose metabolism
    Sde_2717
   00562 Inositol phosphate metabolism
    Sde_2717
Enzymes [BR:sde01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Sde_2717
Exosome [BR:sde04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Sde_2717
  Exosomal proteins of bladder cancer cells
   Sde_2717
  Exosomal proteins of melanoma cells
   Sde_2717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3444195..3444935)
Genome map
AA seq 246 aa AA seqDB search
MRRRLIVGNWKMCGDFRTNQKRLEDLSSLWFGVHQTEVSVSPAYPYLAQAAGMLENTNIS
LCAQDVSTRENGAFTGEVSAAMLADMGCRYVMVGHSERRHYHNEGYDLIAEKFQAVCEAK
MIPILCLGETTADREADRTFDVIGRQLLKVVNACGLEGLAKGVVAYEPIWAIGTGRAATP
EQAQDVHSYIREILGPEGEQIRILYGGSVKPDTAEGLFAKKDIDGALVGGASLDARDFVA
ICRAAE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaggcgactaattgtaggcaactggaagatgtgcggagattttcgtactaaccag
aagcgccttgaggatttatcttcactttggtttggagttcatcaaacggaagtgagtgtt
agccccgcatacccgtatttggcgcaagccgcaggcatgctggagaacacaaatatatcc
ctgtgtgcgcaggatgtaagcacccgagaaaacggggctttcaccggcgaagttagcgcg
gcaatgttagccgatatggggtgcaggtatgtgatggtggggcacagtgagcgccgtcat
tatcacaacgaaggttacgatttaattgcggaaaagtttcaagccgtttgcgaggctaaa
atgattcccattttgtgcttaggcgagaccacagctgatcgcgaagcagatagaacgttt
gacgttattggtcgccagttgttaaaggtggttaatgcgtgtggcttagaagggttggcg
aaaggtgttgttgcctacgagcctatctgggctatagggacggggcgtgcggctacacca
gagcaagctcaagatgtgcactcctacattagggaaatattggggccagaaggcgaacaa
atccgtattttatacggcggtagcgttaagcctgataccgctgaaggattatttgctaaa
aaagatatcgatggtgcattggtggggggggcttcccttgatgcgcgtgactttgtcgca
atatgtcgagcggcagagtag

DBGET integrated database retrieval system