KEGG   Saccharophagus degradans: Sde_2719Help
Entry
Sde_2719          CDS       T00335                                 

Definition
Dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
sde  Saccharophagus degradans
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sde00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sde_2719
Enzymes [BR:sde01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Sde_2719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3446530..3447366)
Genome map
AA seq 278 aa AA seqDB search
MRSPSFLSDLTSPQIMGVLNVTPDSFSDGGRFVSSGKLLLDDALKEAEAMVAAGASIIDV
GGESTRPGAAKVTQEEEMARVLPVVEALASRIDAVISVDTSTPALMRAAVDVGAGLLNDV
RALSKPGALEVAAAASVPVCLMHMQGQPSTMQAQPHYDDVVAEVRAYLLERAQAAIAAGV
KKENIILDPGFGFGKTDEHNVKLLQSLPSLCTTGYPVLAGLSRKSMIGRLLGREPQDRLA
GSLALALIAAQNGAKIIRVHDVAETHDVLSLLTTIQKL
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgcgttctccctcctttctttctgatttaacatcgccgcaaataatgggtgtgcttaac
gttacgccagattctttctctgatggcgggcggtttgtttcgtcgggtaagttgcttcta
gacgatgccctcaaagaggcagaagctatggtcgccgcgggcgcgtcgattattgatgtg
gggggcgaatcaacccgtcccggtgccgccaaggttactcaagaagaagaaatggcgagg
gtgctgccagtcgttgaggcgctggcctcgcgcatagatgcggtaatttcagtggatacc
agcacgccggcgttaatgcgtgcggcggtggacgtaggggcagggctattgaatgacgtt
cgggcgctctcgaagccgggtgcgctggaggtggctgcagctgcaagtgtgcctgtgtgc
cttatgcatatgcaggggcagcctagtactatgcaggcgcagccccattatgatgatgtg
gttgccgaagtgagagcgtatttacttgagcgcgcccaagcagcaattgccgcaggcgtt
aaaaaagaaaacattattctcgaccccggctttggttttggcaaaacagacgaacataat
gtgaagctgttacaatccctgcccagcctttgtactactggttaccctgtgctggcgggg
ttgtcccgcaagtctatgattgggcgcctgctaggccgagagccgcaggacaggttggca
ggtagtttggctttggcccttatagccgcacaaaatggcgcaaaaattattagagtgcac
gatgtggccgagacccatgacgtgttatcgctattaacaacaatacaaaagctttaa

DBGET integrated database retrieval system