KEGG   Saccharophagus degradans: Sde_2931Help
Entry
Sde_2931          CDS       T00335                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
sde  Saccharophagus degradans
Pathway
sde00480  Glutathione metabolism
sde00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:sde00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Sde_2931
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Sde_2931
Enzymes [BR:sde01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Sde_2931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: ABD82188
JGI: Sde2931
UniProt: Q21GJ1
Position
complement(3722689..3723168)
Genome map
AA seq 159 aa AA seqDB search
MASIYDINIQSLQGQLIGFSDFKGKALLIVNTASKCGFTPQYEGLQQLHQQYASEGLVII
GCPCNQFGKQEPGDAKAISEGCLINYGVDFLITEKIHVNGANTHPLYRYLKTALPGFMGN
NIKWNFTKFLIGKDGTPIKRFAPFTKPASMEGAVKKALG
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaatttacgatataaacatacagagcctacaaggccaattgataggttttagc
gactttaagggcaaggccctgttaattgttaatacggcaagcaagtgcggctttacaccg
cagtacgaaggtttacagcagcttcaccagcaatacgccagcgaagggctagtgataata
ggttgcccgtgtaatcagtttggcaagcaagaaccgggggatgccaaggctatttctgaa
gggtgcttaattaactacggggtggattttctaattaccgaaaaaatacacgtgaacggt
gccaatactcacccgttgtataggtatttaaaaaccgcgctaccgggctttatgggcaac
aatataaagtggaactttaccaagtttttaattggtaaagacggcacgcccattaaacgc
ttcgcgccatttactaagcctgcctctatggaaggggcggtaaaaaaagcgttaggttag

DBGET integrated database retrieval system