KEGG   Saccharophagus degradans: Sde_2934Help
Entry
Sde_2934          CDS       T00335                                 

Gene name
xyn10B
Definition
putative xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
sde  Saccharophagus degradans
Brite
Enzymes [BR:sde01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Sde_2934 (xyn10B)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3724831..3726690)
Genome map
AA seq 619 aa AA seqDB search
MIKLRQSIHGALARTVGIISISTGLVLAAQTASAACEYTVTNSWGSGFTASIRITNDTGS
AVNGWAVNWQYANGNRVTNSWNATLSGNNPYSASNIGWNGGIQPGQSVEFGFQGTANGAA
ETPAVTGAVCATGSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSSSSSSSSSSSSGANCV
EMCKWYQDAPRPLCNNQNSGWGWENNQSCIGRATCESQPSNAGGVVNSCPSSSSSSSSSS
SSSSSSSSSSSSSSSSSTSSSSSSTSSTSSSSSSSSGSAANLYTLADFPIGVAVTAGNES
RSFLSIAAKEATVKKHFDQITAGNIMKMSYLHPSENSYTFSQADAMVNWANSNGVSVHGH
TFIWHSDYQVPNWMNNYSGNFASMMDTHVTTIADHFEGRVVSWDVVNEAIDESQSSCYRN
SLFYQRLGKAYIANAFRAARAADPSVELYYNDYDTEGGNANKLNCLLQLVDDLQANNVPI
DGVGFQMHVQIDWPSTSNIAAAFQAIVDRGLKVKITELDVPINNPYGSGSFPQYSTYTSQ
AAALQKARYKSIVKTYLTVVPAHLRGGLTVWGIWDGDSWLLDFDNRQGADDWPLLFSGPA
NGPYVEKEAFYGVAEALTE
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagctacgtcaatctatccacggcgccttggcgcgtaccgtgggcataataagt
ataagcaccggacttgtactcgcagcgcaaactgcaagtgcagcctgtgaatacaccgta
accaattcgtggggttcgggttttaccgcgagtattcgcataacaaacgataccggtagc
gcagtaaacggttgggcggttaactggcaatacgctaatggcaaccgtgtaacaaattca
tggaacgctacgctgtctggcaataacccttatagcgccagcaatattggttggaacggc
ggtattcaacctgggcagtcggtggaatttggttttcaaggcacggctaatggcgcggca
gaaacaccagcggtaacgggggctgtatgtgctacagggtctagctcttccagctcaagc
tctagttcttcgtctagcagctctagttctagcagcagttcgagttcatcgagtagctcg
tctagcacttcaagctcgtcatctagcagctcttccagttcatcgggcgcaaactgtgta
gaaatgtgtaagtggtatcaagatgcgcctcgccctttatgcaataaccaaaatagtggt
tggggttgggaaaacaaccaaagttgtatcggccgagcaacgtgcgaatcgcaaccgtct
aatgcgggtggggtggtaaatagttgtccgtctagttctagcagctcttcaagttcctct
agttcgagctcgtctagcagttcaagctcgtctagcagttcaagctcgtctactagttct
agttcatcaagcacaagttctacttcttcaagtagttctagctctagcggttctgctgca
aacttatataccttggcagatttccccattggcgttgctgtaactgcgggtaatgagagc
cgtagctttttatctattgctgcgaaagaggcaactgttaaaaaacacttcgaccaaatt
acagccggtaacattatgaagatgagttacttgcacccatccgaaaatagctacaccttt
agtcaagcggatgccatggttaactgggcaaatagcaacggcgtaagtgtgcacggccat
acttttatttggcattccgattaccaagtaccaaattggatgaataattacagcggtaat
tttgcgtctatgatggatacccacgtaaccactattgccgatcattttgaaggccgagta
gtaagctgggatgtggtaaacgaagctatcgatgagagccaatctagttgttatcgcaac
tctttgttttaccagcgtttaggtaaagcttatattgccaatgcgttccgcgcggcccga
gcagcagaccctagcgtagagttgtattacaacgattacgataccgaaggtggcaatgcc
aataagttaaattgcttgttgcaattagtcgatgacttgcaagcgaacaatgtgcctatc
gatggtgtgggctttcaaatgcacgtgcaaattgattggcccagcaccagcaatattgct
gcggctttccaagctattgtggatcgcggcttaaaggtaaaaattactgagctggatgtg
cctattaataacccttatggcagtggttcattcccgcaatattcaacttacacgtcacaa
gccgctgcgttgcaaaaggcgcgttataaatccattgtaaaaacctacttgactgttgtg
ccagcgcatttgcgcgggggcttaaccgtatggggtatatgggatggtgatagctggttg
ttagattttgataatcgtcaaggcgctgatgattggccgctattatttagtggcccagct
aatggcccctatgtagaaaaagaagcattctatggcgtggcagaggcgcttacagaatag

DBGET integrated database retrieval system