KEGG   Saccharophagus degradans: Sde_2935Help
Entry
Sde_2935          CDS       T00335                                 

Gene name
gal2C
Definition
putative b-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
sde  Saccharophagus degradans
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sde00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Sde_2935 (gal2C)
  Lipid metabolism
   00600 Sphingolipid metabolism
    Sde_2935 (gal2C)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Sde_2935 (gal2C)
Enzymes [BR:sde01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Sde_2935 (gal2C)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3727209..3729023)
Genome map
AA seq 604 aa AA seqDB search
MDASNNKTGVAIATLTETAVAVPAQKNVTVTANATINNPKLWGPLPTQKPQRYLAVSQIM
QAGIVVDNYQTTFGIRDIAFDPERGVVVNGEPVYIQGVNQHHDLGALGAAFNVRAAERQL
ELLQEMGVNAIRMAHNPPAKELLDLTDKMGFLVIDEIFDSWERKKTPLDFHLIFPEWSEP
DVRNFIRRDRNHPSVIGWSLGNEVGEQYTGEAGAAVAKRLHDIAKSEDPTRPTSVSINFA
KPGMALPPVMDMINLNYQGEGIRNAPEYVHLKGIRTAPLYPKFREAYPNKVIISSENAAA
VSSRGEYFFPVTAGASAPVADGAGGDPNSAHVSAYELYTAPFGSSADKVLGSLADHPYVA
GGFVWSGWDYLGEPTPYYSARSSYFGVIDLAGFKKDRFYLYQAHWRPDLPMAHILPHWNW
PNRVGEVTPVHVFTSGDEAELFLNGKSLGRKIKGKNAFRIRWDNVIYQPGTLKVVAYKNG
KQWAQSVVATTGSASQLQLTGDRTRIRADGKDLAFITVDVQDADATNVPTADNPLSFTLA
GPGEIVATDNGDPTDLTSFTSHTRNAFNGKCLVIVRGVAGKPGALTLNVTGAGLKAAQTV
ITTH
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
ttggatgcatccaataataaaaccggtgtagccattgctacgttaaccgaaaccgccgtt
gccgtaccagcgcaaaaaaatgtaacggtaacggctaacgctacaataaataacccaaag
ctttggggcccgttacccacgcaaaaaccgcagcggtatttggccgtatcgcaaataatg
caagcgggtattgttgtagataattaccaaaccactttcggcatacgcgatatagcgttt
gaccccgagcgcggcgtggtggttaacggtgagcctgtttatattcaaggggtaaatcaa
catcacgacttaggtgcgttgggcgcagcatttaatgtgcgtgcagcggagcgccaatta
gagttattgcaggagatgggcgtaaatgccattcgtatggcgcacaacccgccagcgaaa
gagttgctagacctaacagacaaaatgggctttttagttatcgacgaaatattcgactct
tgggagcgcaaaaaaacaccgctcgactttcaccttatatttcccgaatggtcggaacca
gatgtgcgaaattttattcgccgcgatcgcaaccacccatcggtaataggctggagccta
ggcaacgaagtaggcgagcaatataccggcgaagctggcgcagcagttgcaaaacgactg
catgatattgcaaaaagtgaagacccaactcgacccacttcggtttctattaattttgcc
aagccgggtatggcgttgccgccggttatggatatgatcaatttgaattatcaaggcgaa
ggtattcgcaatgcacctgaatacgtgcacttaaaaggtattcgcaccgcgccgctttac
cccaagtttcgcgaggcttatccaaataaagtaataataagtagcgagaacgcggccgca
gtaagttcgcggggggaatacttttttccggtaaccgcaggtgcaagtgcaccagtagca
gatggtgccggtggtgaccctaattctgcgcacgtaagcgcctacgagctgtataccgcg
ccgtttggttcttctgccgataaagtgctgggttcccttgctgatcacccttatgtggct
ggaggttttgtgtggagcggttgggattatttgggcgaacccaccccttactattccgcg
cgcagctcgtattttggtgtaattgatttggcggggtttaaaaaagatcggttttatttg
taccaagcgcactggcgaccagatttacccatggcccatattctgcctcactggaattgg
cccaatcgagttggcgaagtaacacctgtgcatgtatttacatctggggatgaagctgaa
ttattcctaaacggtaaatcgctaggtagaaaaataaaaggcaaaaatgcatttcgcatc
cgttgggacaacgttatttatcagcccggcacattaaaagtggtggcctataaaaatggt
aagcaatgggcgcaatctgttgttgccactactggcagtgctagccaattacagttaacc
ggagatagaaccagaattcgagcggatggcaaagacctcgcgtttataaccgtagatgtg
caagatgccgatgccacaaacgtgcccactgccgataatccattaagctttaccctagct
ggccctggggaaattgtggccacggataacggtgacccgacggatttaacgtcttttact
tcgcatacccgcaatgcttttaacggtaagtgtttggttattgttcgtggtgttgcgggt
aagccgggtgcgcttaccttaaatgttacgggggcagggctaaaagctgcacaaacggta
ataacaactcattaa

DBGET integrated database retrieval system