KEGG   Saccharophagus degradans: Sde_2994Help
Entry
Sde_2994          CDS       T00335                                 

Gene name
gly30B
Definition
putative retaining b-glycosidase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
sde  Saccharophagus degradans
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sde00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Sde_2994 (gly30B)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Sde_2994 (gly30B)
Enzymes [BR:sde01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Sde_2994 (gly30B)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3811820..3813265)
Genome map
AA seq 481 aa AA seqDB search
MTLLKNINKQRLARKVKLVCSAISLVVMGFSCAASANQYWLTSGDLSAAFEEQGEKYAVA
PSPEMPLITIDKSQAFQTMEGFGYTLNGGSATHLANMSDAARARLLQEIFGQSDGANTNK
PSIGVSYLRLSLGASDLDPAPFSYNDLPPGEVDLKLEKFTIAQDEKTLIPILKQILAINP
NITFMASPWSPPVWMKTNGSTIGGELNPEYYSVYAQYFVKYVQAMAEHGINIDAITIQNE
PMHPGNNPSLLMHAKDQADFIANHLGPAFKQAELKTKIIVWDHNADKPEYPIEVLNHPVA
NQYIHGSAFHLYGGDVNAISQVHNAHPDKHLYFTEQWVGANSNFWGDVAWHVENLIVGAT
RNWCKTVLEWNLAADSNLQPHTLGGCDACLGALTIDGDNVKRNAAYYIIAHAAKHVPPGS
VRIHSHRVAGLPNVAFLTPQKKVVVVVLNNTTQLQSFTLVHDRQKFAYSMPAQSVVTLVI
D
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgacgttactaaaaaatataaataagcaacgcctagcacgtaaagttaaactcgtctgt
agcgcgataagcctagtggttatggggttcagctgtgccgcgtcagccaatcaatactgg
ttaaccagcggtgatctaagtgcggcgttcgaagagcagggcgaaaagtacgcggtagct
cccagccccgaaatgccccttattaccatagataaaagccaagcatttcaaaccatggaa
ggctttggctatacccttaatggcggcagtgcaactcacctagccaatatgagtgacgca
gctagagcgcggctattacaagaaatatttggtcaaagtgatggtgcgaatactaataag
cccagtattggcgtgtcttatttgcgtttaagcctaggcgcatcagatttagaccccgcc
ccgtttagctacaacgatttgccgcctggcgaagtggatttaaagctagaaaaatttact
atcgcccaagatgaaaaaactcttatccccatacttaagcaaatattagctattaaccca
aatattacatttatggctagcccttggtctccgcctgtatggatgaaaacaaacggctct
accattggtggtgagctaaacccagaatactacagcgtatatgcacaatattttgttaaa
tatgttcaagcaatggctgagcacggcataaacatagatgccattactattcaaaatgaa
cctatgcacccgggtaataacccaagcttgctcatgcatgcaaaagatcaagccgacttt
attgctaatcacttaggccccgcgtttaagcaggcagagctaaaaacaaaaatcattgtg
tgggatcacaacgcagacaaacccgaataccccatagaggtactgaatcaccccgttgcc
aatcaatatattcacggctcggcattccatttatatggcggcgatgtaaatgccataagc
caagtgcacaatgctcacccagataagcacttatattttactgagcagtgggtaggcgca
aattccaacttttggggcgatgtagcttggcatgtagaaaatttaattgttggggcaacc
cgcaattggtgcaaaacggtattggagtggaatttagccgcagacagtaacttacagcct
cacactcttggtggatgcgacgcctgcttaggcgcgctaactattgatggcgataacgtg
aagcgcaatgccgcgtattacattattgcccacgcagctaaacatgtaccgccaggctcg
gtgcgtatccattcgcaccgtgtggcgggtttacctaatgttgcttttcttacgccgcag
aaaaaggttgttgtagtagtgcttaataatactactcaattacagtcatttacattggtg
cacgaccgtcaaaagtttgcctattccatgcccgcacagagcgttgtaacgctagttata
gattaa

DBGET integrated database retrieval system