KEGG   Saccharophagus degradans: Sde_3037Help
Entry
Sde_3037          CDS       T00335                                 

Gene name
hex18A
Definition
beta-N-acetylhexosaminidase / beta-hexosaminidase. Glycosyl Hydrolase family 20. (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
sde  Saccharophagus degradans
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sde00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:sde00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3881762..3884149
Genome map
AA seq 795 aa AA seqDB search
MKLRLLPHSISLASLLLLSACQQEHATSTNAQLSPIAPPAISIVPAPVSAEIKTGQFVFG
NSTQLTVNSEKLRDVAQLWADFFNVASGINLQVQSATGNSDEANSVSLELVPASEFSSSN
AEAYELTVTDNAITVRASTRAGIFYGLTSLRQLLPPQIESPSPINSVNWVVPAVAIVDEP
LYPYRGMHLDVSRHFFDVNFIKRYIDILAFHKMNRFHWHLTDDQGWRIPIDAYPLLTEKS
AWRDKTVIGHTYDRDVAYNTNRIGGFYSKEQIRDIVAYAAERQIMVIPEIDVPGHAAAIL
HAYPEFGCIEQVSQVQSNFGIFEQVLCPTEPTFEFLRAVFTEVAELFPGEYLHVGGDEVK
KVQWQQSPFVTELMQREGLKDYHEVQSYFICRVGEIVSSLDKKMLGWNEILDGGIAPNAT
IMSWQGVEGGIAAAELGHDAIMSPGNYVYFDHFQSRSVDEPLAIHGITPLSETYSYNPMP
EQFAGTEKAKHILGAQGQLWTEYVPTTAKAEYMILPRLSAVAEITWTPVNKQSWQSFSER
LPSLFARFDEMGLNAARSVYAITATAKTEGSGEDAKYRVNLASDTAHVIIRYTTDGTLPN
AQSPIYSEPFLVEGDTFVRARSQDKISGNFYLESQLRTVKHKAVGAKLTLLSEANTEWNK
DPVKTLSDGITSIDQIFQLDDWATFFGDEVVAHITFAKAQTVSEVSIGFNPGKHRQMYPP
TRLHILSSSDGETWQSLGEADPQHLATAKNRVSYTFAPTTTRHLRIEAENKTRVLSTESG
KLKSVPLYLDEIIVK
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atgaaactaagattattaccacatagtataagtttagcatcgctattactgctaagtgct
tgccagcaagagcacgcaaccagtacaaacgcgcaactctcccctattgcaccgcctgct
atctctattgttcccgcaccggtttcggcagaaataaaaacagggcagtttgtttttggt
aatagcacacagcttacagttaacagcgaaaagctaagagatgttgcgcagctttgggcg
gatttttttaatgttgctagtggtattaatttacaggttcaaagcgctacaggtaatagc
gatgaagcaaatagcgtaagtcttgagttggtgccggcttcagaattctcatcaagcaat
gcagaagcctatgaattaacggttacagataatgcaataacagtacgcgctagcactcgc
gcgggtattttttacggcttaaccagtttgcgccagttattgccgccgcaaatagaatca
ccctcccctattaattctgtaaattgggttgtacctgcggttgctattgtcgacgagccc
ttatacccctatcgcggtatgcacttagatgtaagccgccactttttcgatgtgaatttt
attaaacgctatatagatatattagcgttccacaaaatgaatcgtttccattggcattta
accgatgaccaaggctggcgtattccgatcgacgcctaccccctactcacagaaaaatcg
gcttggcgagacaaaacggttataggccatacctacgaccgcgacgtagcttacaacact
aatagaataggcggtttttatagcaaagaacaaatacgagacatagttgcttacgctgca
gaacgccaaattatggtaattccagaaatagatgtccccggccacgcagcagctatttta
cacgcttacccagagtttggttgtatcgagcaagtttcacaggtgcaaagcaactttggc
attttcgagcaagtgctttgcccaaccgagccaacctttgaatttttgcgcgcagtgttt
accgaagttgccgagttattccctggcgaatacctacatgtaggtggcgacgaagtaaaa
aaagttcagtggcaacagtcaccctttgttaccgaattaatgcagcgtgaaggtttaaaa
gactaccacgaagtacagagctactttatttgccgcgtaggcgagatagtaagtagctta
gataaaaaaatgttgggctggaacgaaatactcgacgggggtattgctcccaatgcgact
attatgtcttggcaaggtgttgaaggtggtattgctgccgccgagctgggccacgatgcg
attatgtcgccgggaaactatgtgtacttcgatcactttcagtctcgctcggtggatgaa
ccacttgccattcacggtattacaccgttatcagaaacatactcttacaaccccatgccc
gaacaatttgctggcacagaaaaagccaagcacatactcggcgcccaagggcaactgtgg
acagagtacgtgcctaccacagcaaaagcggagtatatgatactgccaagattaagtgcg
gtagcagaaataacctggacaccagtcaacaagcaatcgtggcaaagctttagcgaaagg
ctacccagcctatttgcccgctttgacgaaatgggcttaaacgcagcgcgatctgtttat
gcaattaccgctaccgcaaaaacggaaggcagcggtgaagatgccaaataccgcgtaaac
cttgcctccgatacggctcatgtaattattcgctacacaaccgacggcaccttgccgaat
gcgcaatcgcctatttatagcgaaccatttttagtagaaggcgatacgtttgtgagggcg
cgtagccaagataaaataagtggtaacttctacctggaatcgcaactgcgcaccgtaaaa
cacaaagccgttggcgccaagctaacactgttaagcgaagcgaatacagagtggaataaa
gacccagtaaaaaccttaagtgatggcattacttcgatagaccaaatatttcaactcgac
gactgggccacattttttggcgacgaggttgttgcacatataaccttcgctaaggcacaa
accgttagcgaagtaagcattggctttaaccctggcaagcatcgccaaatgtacccaccc
actcgtttgcatattttaagctcaagcgatggcgaaacatggcaaagcttgggtgaagcc
gacccacaacaccttgccaccgcaaaaaatcgcgtaagttacacctttgcaccaacaacc
actcgccacctacggatagaggcggaaaataaaacccgcgtactaagtaccgaaagcggt
aagctaaaaagcgttcccctatacttagatgaaataatcgttaaataa

DBGET integrated database retrieval system