KEGG   Saccharophagus degradans: Sde_3037Help
Entry
Sde_3037          CDS       T00335                                 

Gene name
hex18A
Definition
beta-N-acetylhexosaminidase / beta-hexosaminidase. Glycosyl Hydrolase family 20. (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
sde  Saccharophagus degradans
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sde00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Sde_3037 (hex18A)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Sde_3037 (hex18A)
Enzymes [BR:sde01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Sde_3037 (hex18A)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3881762..3884149
Genome map
AA seq 795 aa AA seqDB search
MKLRLLPHSISLASLLLLSACQQEHATSTNAQLSPIAPPAISIVPAPVSAEIKTGQFVFG
NSTQLTVNSEKLRDVAQLWADFFNVASGINLQVQSATGNSDEANSVSLELVPASEFSSSN
AEAYELTVTDNAITVRASTRAGIFYGLTSLRQLLPPQIESPSPINSVNWVVPAVAIVDEP
LYPYRGMHLDVSRHFFDVNFIKRYIDILAFHKMNRFHWHLTDDQGWRIPIDAYPLLTEKS
AWRDKTVIGHTYDRDVAYNTNRIGGFYSKEQIRDIVAYAAERQIMVIPEIDVPGHAAAIL
HAYPEFGCIEQVSQVQSNFGIFEQVLCPTEPTFEFLRAVFTEVAELFPGEYLHVGGDEVK
KVQWQQSPFVTELMQREGLKDYHEVQSYFICRVGEIVSSLDKKMLGWNEILDGGIAPNAT
IMSWQGVEGGIAAAELGHDAIMSPGNYVYFDHFQSRSVDEPLAIHGITPLSETYSYNPMP
EQFAGTEKAKHILGAQGQLWTEYVPTTAKAEYMILPRLSAVAEITWTPVNKQSWQSFSER
LPSLFARFDEMGLNAARSVYAITATAKTEGSGEDAKYRVNLASDTAHVIIRYTTDGTLPN
AQSPIYSEPFLVEGDTFVRARSQDKISGNFYLESQLRTVKHKAVGAKLTLLSEANTEWNK
DPVKTLSDGITSIDQIFQLDDWATFFGDEVVAHITFAKAQTVSEVSIGFNPGKHRQMYPP
TRLHILSSSDGETWQSLGEADPQHLATAKNRVSYTFAPTTTRHLRIEAENKTRVLSTESG
KLKSVPLYLDEIIVK
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atgaaactaagattattaccacatagtataagtttagcatcgctattactgctaagtgct
tgccagcaagagcacgcaaccagtacaaacgcgcaactctcccctattgcaccgcctgct
atctctattgttcccgcaccggtttcggcagaaataaaaacagggcagtttgtttttggt
aatagcacacagcttacagttaacagcgaaaagctaagagatgttgcgcagctttgggcg
gatttttttaatgttgctagtggtattaatttacaggttcaaagcgctacaggtaatagc
gatgaagcaaatagcgtaagtcttgagttggtgccggcttcagaattctcatcaagcaat
gcagaagcctatgaattaacggttacagataatgcaataacagtacgcgctagcactcgc
gcgggtattttttacggcttaaccagtttgcgccagttattgccgccgcaaatagaatca
ccctcccctattaattctgtaaattgggttgtacctgcggttgctattgtcgacgagccc
ttatacccctatcgcggtatgcacttagatgtaagccgccactttttcgatgtgaatttt
attaaacgctatatagatatattagcgttccacaaaatgaatcgtttccattggcattta
accgatgaccaaggctggcgtattccgatcgacgcctaccccctactcacagaaaaatcg
gcttggcgagacaaaacggttataggccatacctacgaccgcgacgtagcttacaacact
aatagaataggcggtttttatagcaaagaacaaatacgagacatagttgcttacgctgca
gaacgccaaattatggtaattccagaaatagatgtccccggccacgcagcagctatttta
cacgcttacccagagtttggttgtatcgagcaagtttcacaggtgcaaagcaactttggc
attttcgagcaagtgctttgcccaaccgagccaacctttgaatttttgcgcgcagtgttt
accgaagttgccgagttattccctggcgaatacctacatgtaggtggcgacgaagtaaaa
aaagttcagtggcaacagtcaccctttgttaccgaattaatgcagcgtgaaggtttaaaa
gactaccacgaagtacagagctactttatttgccgcgtaggcgagatagtaagtagctta
gataaaaaaatgttgggctggaacgaaatactcgacgggggtattgctcccaatgcgact
attatgtcttggcaaggtgttgaaggtggtattgctgccgccgagctgggccacgatgcg
attatgtcgccgggaaactatgtgtacttcgatcactttcagtctcgctcggtggatgaa
ccacttgccattcacggtattacaccgttatcagaaacatactcttacaaccccatgccc
gaacaatttgctggcacagaaaaagccaagcacatactcggcgcccaagggcaactgtgg
acagagtacgtgcctaccacagcaaaagcggagtatatgatactgccaagattaagtgcg
gtagcagaaataacctggacaccagtcaacaagcaatcgtggcaaagctttagcgaaagg
ctacccagcctatttgcccgctttgacgaaatgggcttaaacgcagcgcgatctgtttat
gcaattaccgctaccgcaaaaacggaaggcagcggtgaagatgccaaataccgcgtaaac
cttgcctccgatacggctcatgtaattattcgctacacaaccgacggcaccttgccgaat
gcgcaatcgcctatttatagcgaaccatttttagtagaaggcgatacgtttgtgagggcg
cgtagccaagataaaataagtggtaacttctacctggaatcgcaactgcgcaccgtaaaa
cacaaagccgttggcgccaagctaacactgttaagcgaagcgaatacagagtggaataaa
gacccagtaaaaaccttaagtgatggcattacttcgatagaccaaatatttcaactcgac
gactgggccacattttttggcgacgaggttgttgcacatataaccttcgctaaggcacaa
accgttagcgaagtaagcattggctttaaccctggcaagcatcgccaaatgtacccaccc
actcgtttgcatattttaagctcaagcgatggcgaaacatggcaaagcttgggtgaagcc
gacccacaacaccttgccaccgcaaaaaatcgcgtaagttacacctttgcaccaacaacc
actcgccacctacggatagaggcggaaaataaaacccgcgtactaagtaccgaaagcggt
aagctaaaaagcgttcccctatacttagatgaaataatcgttaaataa

DBGET integrated database retrieval system