KEGG   Saccharophagus degradans: Sde_3046Help
Entry
Sde_3046          CDS       T00335                                 

Definition
MCP methyltransferase, CheR-type
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
sde  Saccharophagus degradans
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:sde00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Sde_3046
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Sde_3046
Enzymes [BR:sde01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Sde_3046
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Sde_3046
Two-component system [BR:sde02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Sde_3046
Bacterial motility proteins [BR:sde02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Sde_3046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3894877..3897909
Genome map
AA seq 1010 aa AA seqDB search
MANQSDSKLVPNYYVAIGASAGGLEALHEFVQELPSDSGAAFIIIQHLSPDFKSVMAELL
SRHTSMPIYNAEDGAVVEANTIYLIPARKNMMIAEGKLLLADQMPDTGIHFPIDIFFRSI
AEDQHHHSMGVILSGTGSDGSRGLLAIKEVGGLVLVQDPASAKFDGMPFNAVKTGVVDVV
ASASELPAKIVNYITHPIVSGSEKALTSAVKSDTGALKEIYQLLREKSNIDFTQYKPATV
ERRIERRIGINGLSSLQEYYNFILKHPPEMAILSKDMLIGVTRFFRDDEPFKMLETKIIP
SILDDTPVTEPIRVWVAGCSTGEEAYSIAILFDEAMNERAEARSIKIFATDVDPDAIAEA
SAGEFSTNILTDMSETRFKKYFTHTSSHATIASNIRQMVVFATHNLMKDPPFSNTQLAIC
RNVLIYFQPPAQRRVLSMLHFSLKKNGYLFLGNSETLGDLASHFETTHERNRFYRKISNV
RSVHNTMSNIGSVNAKNPAMPSVEQLYRSYQRNQPASSFPSITESLIQDYAPPAIVLDGD
LEILHVYGDVTAYTRKLQPGKFRSSIEDVISPDLEIAVSTALHRARTEEDSVKYDNIQVT
TDNGQTENINLRVRCVKQSSAAIQLYFIVIFEPSQRVITSTDTSLTFDAKDQVQQRIRDL
ELQLHQKQEHLQVIIEELETTNEELQSSNEELMAANEELQSTNEELQSVNEELYTVNSEY
QEKIEEITRINTDLDNIIKSTDIGIIFLDNAMLIRNYTPAATQAVNLLPSDIGRPFHHIS
HKLHYNGLLKDVAKVIEDGLRIEKNIQTVHGNIMSITLTAYIDEFNVNNGCVITLTDNTE
KVNLKARLVDSYNELRGTINTSLVSSSTKVQVLILDDDPDDCLLVKHQLNGDAQLSGDFQ
ATAVHTLEEAQALLQKTHFDVCLVDYYLGNRNGLELIETLADPKSSTAFIVLSGALQNAT
REKALELGVYDAIDKAHMTPYLLERSIRYAIRHKKTELFLLAQTLNTPTI
NT seq 3033 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaccaaagtgacagcaaacttgtgcccaattattatgtagctataggcgcatct
gcaggcgggttagaagccctacacgagtttgtccaggagctacctagcgacagcggtgct
gcttttataatcattcagcatctttcacccgacttcaaatcggtaatggcagagctgtta
agccgtcacaccagcatgccaatatacaacgcggaagatggcgctgttgtagaagctaac
actatctaccttattcccgcgcgcaaaaacatgatgatcgcggagggcaagcttttactc
gccgaccaaatgccagataccggcatacactttcctatcgatatatttttccgctccata
gcagaagatcaacaccaccactctatgggtgtaatcctttctggtacagggagcgatggc
agcagagggctgctcgccattaaagaggtaggcggcctcgttttggtgcaagacccagcg
tcggccaaattcgacggtatgcctttcaatgcagtgaaaactggcgtggtcgatgtggtt
gcgtcagcatcagagctgcctgctaaaatagtaaactatataacccatccaattgtgagt
ggcagcgaaaaagcacttactagtgcagttaaaagcgatacaggcgcgcttaaagagatt
tatcaattattgcgcgaaaaaagcaatatcgactttacccaatataaaccggctaccgta
gagcggcgtatagaaagacgtataggtataaacgggttaagcagcctacaagagtattac
aactttattttaaagcacccaccggaaatggccatcctatcgaaggatatgcttattggc
gtaacacggtttttccgcgatgacgaaccattcaaaatgctggaaaccaaaatcattcca
tctatattggatgacaccccagtaacagagccaattagagtttgggttgcaggctgttca
acaggcgaagaagcctattccattgcgatactctttgacgaggcaatgaacgaacgcgcg
gaagcaagatcgataaaaatatttgcaacagatgtagacccagatgccattgcggaagct
agtgcaggggagttcagtaccaacattcttaccgatatgagtgaaactcgctttaaaaag
tatttcactcatacatctagccacgccactattgcatccaatattcggcaaatggtggta
ttcgctacgcacaatttaatgaaagacccacccttctctaatacgcaactcgctatttgt
cgcaacgtgcttatttattttcagccaccagcccaaagacgtgttttgtctatgctgcat
ttttcattaaagaaaaacggctacctatttttaggcaactcagaaacactaggcgatttg
gcctcgcattttgaaactacccacgagcgcaaccgcttttatcgcaaaatatccaatgtt
cgtagcgtgcataatactatgtccaatattggctcagtaaacgcaaaaaaccctgcgatg
cccagcgtagagcagctataccgaagctaccaacgcaatcaacctgcatctagctttcct
tcaattactgagtctcttattcaagattacgcaccaccggcgatagtactggatggcgac
ctagaaattttacatgtatatggtgatgtgacggcctacacccggaaactacaaccaggg
aaatttagatcgagcattgaagatgtaataagccccgacctagaaattgcggtatcaacg
gccctgcatcgtgcgcgcacagaagaagacagcgtcaaatacgataacattcaagtaaca
acagataacggtcaaacagaaaatatcaatttacgggtacgctgcgtcaaacaaagtagc
gcggctatccagctttactttattgttatttttgaaccatcccaaagagttattacatca
acagacacgtcgctaacctttgacgccaaagatcaagtacaacaacgtattcgcgaccta
gaacttcagctgcaccaaaagcaagagcacctgcaagttattattgaagagctcgaaacc
accaatgaagagctgcaatcttccaacgaagaattaatggcagccaacgaagaactgcaa
agcactaacgaagagttgcagtcggtaaacgaagagctgtacaccgttaacagcgaatac
caagagaaaattgaagaaataacgcgcataaataccgatttagacaacattattaaatcg
acagatataggcattattttcttagataacgccatgcttattcgcaactacaccccagct
gccacgcaagcggtgaacttattaccctccgatattggcaggccgttccatcatatttca
cacaaactacactacaatggcctattaaaagatgtagccaaggttattgaggatggcctg
cgaatagagaaaaacattcaaacagtacacggtaatattatgagtattacactcactgct
tacattgatgaattcaatgtaaataatggttgtgtaattacgcttaccgacaacaccgaa
aaagtaaatttaaaagctcgcctagtagacagctacaacgagctgcgaggtacgatcaat
acttcgctggtatcatctagcactaaagtacaagtactcatccttgatgacgacccagat
gattgcctgctagttaagcaccagttaaatggcgacgcgcaattaagtggcgattttcaa
gccactgcagtacacaccctagaagaagcacaagctctattgcaaaaaacacactttgac
gtatgtttagtagattattacttgggcaatagaaacggattggaactaatagaaacacta
gcagaccccaaatccagtactgcatttattgtgctttctggcgctttgcaaaacgctacc
cgcgaaaaagcgcttgaacttggggtttacgacgcgatagacaaagcgcacatgacaccc
tacttgctagagcgcagcattcgctacgccattaggcataaaaaaaccgagctgttcttg
ctcgcgcaaacgctaaacacacccacaatttaa

DBGET integrated database retrieval system