KEGG   Saccharophagus degradans: Sde_3210Help
Entry
Sde_3210          CDS       T00335                                 

Definition
putative sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
sde  Saccharophagus degradans
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:sde00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sde_3210
Enzymes [BR:sde01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Sde_3210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4086377..4088167
Genome map
AA seq 596 aa AA seqDB search
MGKRFKISEQPMISLQKELRFLVETHLRFIYDEQSYPDLDHAQLARKLIKIVELDEQCLK
PAVHESLWDEQDVLVITYGDSIKKEGEPPLDTLNNFFNKHLADTVNGVHILPFFPYSSDD
GFSVIDYTQVNDGLGDWGDIEEIASNFDLMADLVVNHCSSRSRWFDNFKQCKEPGKNYFF
ECDPSADTSDVVRPRTSPLLREVETLEGKKYVWCTFSHDQVDLNFANPDVLCEMIQIIKL
YLDRGVKIFRMDAVAFVWKELGTPCIHHPKTHELVRLMRTLIEHHSPRAIIITETNVPNH
ENLSYFGNANEAHAVYNFSLPPLLLNALITGSSAHLKAWQMSMPPAQEGTFYFNFIASHD
GIGLRPAEGLLQDQEIDTLINTMQSFGARISWRAAQGGLNKAYEINVTLFDALQGTTKGP
DKWQIQRFLCAHGIMLALEGIPAIYIHSLVATNNYQEGVELTASNRTINRYKWDADELET
QLATEHTHHAKVFEQLKRLISIRRGQQAFHPNATQFTLHLGDQLFGFWRQSIRRDQSIFC
IYNVTDDTVTIPLSSINLISLNKWVDLVSGQEYTDLHLDLVLEPYQFVWLTNKIAC
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagcgttttaagataagcgagcagcctatgatttccttgcaaaaagaattacgt
tttttagtcgaaacccatctgcgctttatttacgatgagcaatcgtacccagacctcgac
cacgcacagttggcccgcaagcttattaaaattgtagagttagacgagcagtgcttaaaa
ccggccgtacacgaaagcctgtgggacgaacaagacgtgctcgttattacctacggcgac
agcataaaaaaagagggcgaaccgccactcgatacactaaataattttttcaacaaacac
ctagccgacacagttaacggtgtccatattttgccgttcttcccctatagctcggatgac
ggattctcggttattgattacacgcaagtaaacgatggcttgggcgactggggcgatata
gaagaaatagccagtaattttgatttaatggccgacctagtcgtaaaccactgctctagt
cgcagccgatggttcgacaatttcaaacaatgcaaagagcccggcaaaaattattttttt
gagtgcgaccccagcgccgacacctccgatgtagtacgcccgcgcacctcgccattgttg
cgcgaggtggaaacactagaaggcaaaaaatatgtgtggtgtacctttagccacgaccaa
gtagaccttaactttgccaaccccgacgtactgtgcgaaatgattcaaatcattaaattg
tatttggatcgcggcgtaaaaatatttcgtatggatgccgtggcgtttgtttggaaagag
ctcggtaccccctgcattcaccatcctaaaacccacgagctggtgcgtttaatgcgtacg
cttattgagcaccactcccccagagcaatcattattaccgaaaccaatgtgcccaaccac
gagaacttatcttactttggtaacgccaacgaagcacatgcggtgtataacttttcccta
ccccctcttttgctgaatgcattaattacgggtagcagcgcgcatttaaaggcctggcaa
atgagcatgccacccgcacaggagggcacattttattttaactttatcgcctctcacgat
ggcattggcctaaggcctgcagaagggctactgcaagatcaagaaattgatacgctaatt
aacaccatgcaatcatttggcgcgcgcatttcatggcgtgcggcacagggcggcttaaat
aaagcctatgaaataaacgtcaccctgttcgatgccctgcaaggcacaaccaaagggccc
gataaatggcaaatacaacgctttctatgtgcccacggcattatgttggcactagagggc
attcccgccatttatattcacagcttagtggccaccaacaattaccaagaaggcgtagag
ttaaccgcatctaaccgcacgattaatcgctacaaatgggatgccgacgagctagaaact
cagctcgccaccgaacacacccatcacgcaaaagtatttgagcaattaaaacgcttgata
agcataagaagaggccagcaggcattccaccctaatgccacccaatttacgctgcacctt
ggcgatcaattatttggtttttggcgccaaagtattcgtagggaccaaagtattttttgc
atttacaatgttactgacgataccgtcaccatccccctttcttcaattaatcttattagt
ttgaacaaatgggtagacttagtaagcgggcaagaatacacagacttgcatttagaccta
gtattagagccgtatcaatttgtttggctaaccaacaaaatagcttgttaa

DBGET integrated database retrieval system