KEGG   Saccharophagus degradans: Sde_3237Help
Entry
Sde_3237          CDS       T00335                                 

Gene name
cel5H
Definition
putative endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
sde  Saccharophagus degradans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sde00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4125970..4127862
Genome map
AA seq 630 aa AA seqDB search
MKSATTNQSRARSSAFKNMLAASLAGLGLLSASAFADVAPLTVDGNKILSGGQQASFAGN
SLFWSNNGWGGEKYYTAGTVEWLKQDWGSNLVRAAMGVDENGGYLEDPAGNKAKVTTVVD
AAIANDMYVIIDWHSHHAEDYQNQAISFFQDMARTYGNNNNVIYEIYNEPLQVSWSGTIK
PYAEAVIGAIRAIDPDNLIIVGTPTWSQDVDVASRDPITQYSNIAYTIHFYAGTHKQSLR
DKAQTALNNGIALFATEWGTVNANGDGGVDAAETDRWMQFFKANHISHANWALNDKAEGS
SALKPGSNANGGWSNSDLTASGTYVKNLIKTWNDGSPSSSSSSSTSSSSSSSSSSSSSSS
SSSSSSSGGTNLPARIEAENYDSAPVETTAGNSGSPTNCSYKGMGVDVENSTEGACNIGW
TAAGEKVTYNIGNADGTYDIALRVASMDAGKRISVHVNNSLADTVTTQGGGWQAWTTETI
SNVYIPSNSVITVEFYDSGSNLNFLNITESSGTEPPVEPPVEPPVEPPVDNGNFPCNDGN
STLANNGASINLNQGACVKYNHGWGDIRLGTWSGNGTIRYDVLDCNNNVMSDIAQKLNDF
TAVDTATMNCAHYIYVKQAPSSYTLQFGSW
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcagcaaccacaaatcaatcgagggcacgcagtagcgcctttaaaaatatgttg
gcggcatcgctcgcaggtttagggctactatcagcttctgcatttgccgatgtagccccg
ctaaccgtagacggcaataaaattcttagcggtggccagcaagccagttttgccggtaat
agcttattttggtctaacaatggctggggcggtgagaagtattacacggccggtaccgtt
gaatggctaaagcaagactggggcagtaatttagttcgcgccgcaatgggtgtcgatgaa
aacggcggctacttagaagacccagcaggaaacaaagcgaaagtaacaaccgttgtagat
gcagccatcgctaacgatatgtatgtaattatcgattggcacagccaccacgccgaagac
taccaaaaccaagccattagctttttccaagatatggctcgcacctacggtaacaacaac
aacgttatatacgaaatttataacgagccattacaggtttcttggagcggcaccatcaag
ccttacgcagaagcggtaattggcgcaattcgcgcaatcgacccagataaccttattatt
gtgggcacgcctacttggtcgcaggatgtagacgtagcctcgcgcgaccccatcacgcag
tacagcaacattgcctacactattcacttttatgcgggcacccacaaacaatccctacgc
gataaagcacaaaccgcattaaataatggtattgctttgtttgctaccgaatggggtaca
gtaaatgccaacggtgacggcggtgtagacgcagccgaaactgatcgttggatgcagttt
tttaaagcgaatcatataagccatgccaactgggccttaaacgataaagccgaaggctct
tctgcattaaagcctggctctaacgcaaacggcggctggagcaattccgacttaaccgcc
tctggtacctatgttaaaaacttaattaaaacatggaacgacggctcaccgagcagcagc
tcatctagcagcaccagttcttcttcaagcagctcctcgtctagtagctcatcatctagc
agctcttcatctagtagttctggcggtaccaatttacccgcgcgcattgaagcagaaaac
tacgatagcgcaccggtagaaaccactgcaggtaatagcggctcacccaccaattgttcg
tataaaggtatgggcgtagatgtagaaaactctactgaaggtgcttgtaatattggctgg
actgcggcaggcgaaaaagtaacttacaacattggcaatgccgatggcacttacgatatt
gcattgcgcgtagcctctatggatgcgggcaaacgtatctctgtgcatgtaaacaacagc
ctagcagataccgtaaccacacaaggtggcggctggcaggcatggactaccgaaaccatt
tctaacgtgtatatcccatcaaactcggtaattaccgttgagttttacgatagtggctct
aacctaaactttttaaacattaccgaaagctcgggtaccgaaccacctgtagaaccaccc
gttgagccgccagtagaaccacccgtagacaacggtaacttcccatgtaacgacggtaac
tctacgcttgccaacaacggcgcctccattaaccttaaccaaggagcgtgtgttaaatac
aatcacggctggggcgatattcgtttaggcacctggagcggcaacggtaccattcgatac
gacgtactagactgcaataacaacgtaatgagtgatattgcacaaaaacttaatgacttt
actgctgtagacaccgcaacaatgaactgcgcacactacatttatgtaaaacaagcccct
agcagctacaccctgcaatttggtagctggtag

DBGET integrated database retrieval system