KEGG   Saccharophagus degradans: Sde_3255Help
Entry
Sde_3255          CDS       T00335                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sde  Saccharophagus degradans
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:sde00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4153773..4154639
Genome map
AA seq 288 aa AA seqDB search
MLQTSLTLPAPAKLNLFLHITGRRPDGYHNLQTVFQLLDFGDELTFTPNQSGEITITPAI
EGVPLEQNLVYKAANILRSHVNRPELGATIHLTKRLPMGGGIGGGSSDAATTLVGLNYLW
QTGVSPTTLAQLGRQLGADVPVFVEGNSAWAEGIGEQLIALDLPQYWYVVLTPACHVSTV
EIFSHKDLTRDTLAITVAAFFEKGGKNDCQPLVERLFPQVRDAVDWLNKFGPAKLTGTGA
SVFAAFPSKDAAQKVFANKPKHLNGFVAQGVNESPLHQRLPEQCITGV
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaaacaagccttacactgcccgcccccgccaagctgaacctatttttgcacatt
accggccggcggcccgacggttaccacaacctacaaaccgtgtttcagctattggatttt
ggcgacgaacttacctttacccccaaccaaagcggcgaaataaccataaccccagccata
gagggagtacccctagagcaaaatctagtatacaaggcggccaatattttgcgcagccat
gtaaaccggcctgaattgggtgcaacaatacacttaaccaaacgcctacctatgggcgga
gggattggcggcggcagcagtgatgccgccacaacactcgtaggcttaaactatttgtgg
caaaccggcgttagccctaccaccctcgcacagcttggccgccagctaggcgcagacgtg
cctgtttttgtagaaggtaacagtgcatgggcagaaggcataggggaacaattaatagcc
ttagatttaccccaatattggtatgttgtgcttactcctgcctgtcatgtgtccacagta
gaaattttttcacataaagatttgacaagggacactctcgccattacagtagcggccttc
tttgagaagggtggaaaaaacgactgccaaccactggttgaaagactttttccacaggta
agggatgcggttgactggctcaataaatttggcccagcgaagcttacaggtacgggcgca
agtgtatttgcagccttcccctctaaagatgctgcgcaaaaagttttcgccaacaaacca
aaacatttgaatggttttgtagctcaaggcgttaacgagtcaccactgcatcaacgcctc
ccggagcagtgtataactggggtgtag

DBGET integrated database retrieval system