KEGG   Saccharophagus degradans: Sde_3278Help
Entry
Sde_3278          CDS       T00335                                 

Definition
fructose-1,6-bisphosphatase
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
sde  Saccharophagus degradans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sde_3278
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sde_3278
   00030 Pentose phosphate pathway
    Sde_3278
   00051 Fructose and mannose metabolism
    Sde_3278
  Energy metabolism
   00680 Methane metabolism
    Sde_3278
Enzymes [BR:sde01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Sde_3278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4186558..4188306)
Genome map
AA seq 582 aa AA seqDB search
MTSNALKVFISDLHGELDVFDFLADRQFGILHLLIRQQFSPELNETLCAAIEASAIRLCR
AANASQAQLDRTSAVSKEILFTALFLMVVQQKAEDESLTIAIRRWGWLSTVHRALSGDAQ
LSCTPFSQLVEMLAQNIRTLSAQDFFALVQAFAKALFKKLSPELNIVGDIYDRGQDAFAI
MERLRGLPNVAIQWGNHDVVWMGAASGNLACITVAVRICLRYGTLDMLHRDYGINLSRLE
RFAAKAYGDDDCAQFTPKGDLNAEEKLRIARMHKAISIIQFKLEGKLIARRPEYTMADRL
LLDKINIANSTVTVGDAVHPLLDSNFPTLDVEQPYRLSEDERKVAEDLKQQFLASAKLTQ
HMDILFHRGGMQKKTGDWLLYHACVPVDEQGEFQPFALAPETTRGQSLFNFCELEMRRGY
LNRMVINDRNESDIAWFLWCGPHSPLFGKARMTTFERYFVADKQTHKEGKNEYYNLRSNP
EFLARVATELKCSSDQVRIVNGHVPVKYQSGERPVQANGKLFSIDGGFSMPYRSATGLAG
FVLLEALGQIVLYRVIPNDKRYALEVEYQQILKPKAASVPAA
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagcaacgcattaaaagtatttatctccgatcttcatggcgaactcgatgttttt
gattttctcgccgaccgccaattcggcatacttcatctattaattcgccagcaattttct
cccgagctaaatgaaactctgtgcgcggctattgaggctagcgctattcgtttatgccgt
gctgcaaacgctagccaagctcagctcgatcgcactagtgctgtaagcaaagaaatactt
tttacagcactttttttaatggtggtacagcaaaaagcagaagacgagtcgcttactata
gctattcgccggtggggctggttgtctaccgtgcatcgggccttaagtggtgatgcgcag
ttaagttgtacgccatttagtcagcttgttgaaatgcttgcgcagaatattcgcacttta
agtgcgcaagattttttcgcgctagtgcaggcgtttgcaaaagcgttatttaaaaagtta
agcccagaattgaatatagttggcgatatttatgatagagggcaagatgctttcgccatt
atggagcgattgcgcgggctgccgaatgtggctattcagtggggcaatcacgatgtagtg
tggatgggtgctgcgtcgggcaaccttgcgtgtattacggtggcggtgcgtatttgtttg
cgctacggcacgttagatatgttgcaccgcgattacggtatcaacctctctcgtttagaa
cggtttgctgctaaagcctacggcgatgatgattgtgcgcagtttacccccaagggcgac
cttaacgctgaagaaaagctgcgcattgcgcgtatgcacaaagccatatcaattattcaa
tttaagcttgaaggtaagcttattgcccgtcggccagaatatacaatggccgatagactg
ctgttggataaaataaatattgccaatagcacggttactgtgggtgatgctgtgcatcca
ctattagactcgaattttcctacgctggatgtagagcagccttatcgcttaagtgaagat
gaacgcaaagttgcagaagatcttaagcagcagtttcttgccagcgcaaagcttacccag
catatggatatactttttcaccgcggtggaatgcaaaagaaaacaggagattggctgctt
tatcacgcctgtgtacccgttgacgaacagggagagtttcaaccttttgcgcttgcacca
gaaaccacacgtggacaaagcctgtttaacttctgcgagctggaaatgcggcgcggttat
ttaaatagaatggtcattaatgaccgcaatgagtccgatattgcttggtttttatggtgc
ggccctcattctcctttatttggcaaagccagaatgaccacctttgaacgctattttgtg
gccgataagcaaacccacaaagaaggtaaaaatgaatactacaaccttcgctccaaccct
gagtttttagcacgcgttgccacggaattaaaatgcagtagcgatcaggtgcgcattgta
aatggacacgtgccggttaagtatcaatctggcgagcgcccagtgcaggccaatggcaag
ctcttttctattgatggcgggttctctatgccctatcgctcagccaccggtttggcgggc
tttgtactgcttgaagcgcttggtcaaatagttttatatcgggtaatccccaacgacaag
cgctatgctttagaagtggaatatcaacaaatactaaagcctaaagctgcaagtgtgcct
gctgcttag

DBGET integrated database retrieval system