KEGG   Streptococcus dysgalactiae subsp. equisimilis ATCC 12394: SDE12394_00225Help
Entry
SDE12394_00225    CDS       T02017                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
sdg  Streptococcus dysgalactiae subsp. equisimilis ATCC 12394
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sdg00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SDE12394_00225
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SDE12394_00225
   00620 Pyruvate metabolism
    SDE12394_00225
   00650 Butanoate metabolism
    SDE12394_00225
  Lipid metabolism
   00071 Fatty acid degradation
    SDE12394_00225
  Amino acid metabolism
   00350 Tyrosine metabolism
    SDE12394_00225
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SDE12394_00225
   00626 Naphthalene degradation
    SDE12394_00225
Enzymes [BR:sdg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SDE12394_00225
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SDE12394_00225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
56085..58727
Genome map
AA seq 880 aa AA seqDB search
MTEGHNTVETTSVSATIDTLVQKGLAALEEMRKLGQEQVDYIVAKASVAALDAHGELAKH
AYEETGRGVFEDKATKNLFACEHVVNNMRHQKTVGIIEEDDVTGLTLIAEPVGVICGITP
TTNPTSTAIFKSLISLKTRNPIIFAFHPSAQESSAHAARIVRDAAIAAGAPENCVQWVET
PSLEATNALMNHDGIATILATGGNAMVKAAYSCGKPALGVGAGNVPAYVEKSANIRQAAH
DIVMSKSFDNGMVCASEQAVIVDKEIYDDFVAEFKSYHTYFVNKKEKALLEEFCFGAKAN
SKNCAGAKLNPNIVGKPAAWIAEQAGFTVPEGTNILAAECKEVSENEPLTREKLSPVIAV
LKSESREDGVEKARQMVEFNGLGHSAAIHTADAELAKEFGTRIRAIRVIWNSPSTFGGIG
DVYNAFLPSLTLGCGSYGRNSVGDNVSAVNLLNIKKVGRRRNNMQWFKVPSKTYFERDSI
QYLQKCRDVERVMIVTDHAMVELGFLDRIIEQLDLRRNKVVYQIFADVEPDPDITTVMKG
TELMRTFKPDTIIALGGGSPMDAAKVMWLFYEQPEVDFHDLVQKFMDIRKRAFKFPELGK
KTKFIAIPTTSGTGSEVTPFAVISDKANNRKYPIADYSLTPTVAIVDPALVLTVPGFIAA
DTGMDVLTHATEAYVSQMANDFTDGLALQAIKIVFETLEKSVKEADFESREKMHNASTMA
GMAFANAFLGISHSMAHKIGAQFHTVHGRTNAILLPYVIRYNGTRPAKTATWPKYNYYRA
DEKYQDIAKLLGLPASTPEEAVESYAKAVYDLGCRVGIKMNFKDQGIDENEWKEHSRALA
YLAYEDQCSPANPRLPMVDHMQEIIEDAYYGYAERPGRRK
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaggacataacactgttgaaacaacctctgtttctgcgacaattgatactctt
gttcaaaaaggtttagctgctcttgaagagatgcgtaagcttggccaagaacaagttgac
tatatcgtagcaaaagcttctgttgctgccttggatgcacacggagaacttgctaaacat
gcttacgaagaaacaggtcgtggtgtctttgaagataaagcaacaaaaaatctatttgct
tgtgagcatgtggttaataacatgcgccatcaaaaaacagtagggattattgaagaagat
gacgtgacaggtttgacgttgattgctgagccggtgggtgttatctgtgggattacgcca
acaactaacccgacttcaacagctatctttaaatctttgatctcgttaaaaacacgtaat
ccaatcatttttgctttccacccatctgctcaagaatcatcagcacatgccgctcggatt
gttagagacgctgctatcgccgctggtgctcctgagaactgtgttcagtgggttgaaaca
ccatcacttgaagcaacaaatgctttgatgaatcatgatggcattgcaaccatccttgct
acaggtggaaatgctatggttaaagcagcttactcatgtggaaaacctgctcttggggta
ggtgcaggtaatgttccagcctatgtggaaaaatctgctaacatccgccaagcagctcat
gatattgttatgtcaaaatcatttgacaacggtatggtctgtgcatctgaacaagctgtt
atcgtggacaaagaaatctatgacgattttgttgcagagttcaaatcttaccatacttat
tttgtaaataaaaaagaaaaagcccttcttgaagaattctgttttggtgcaaaagctaac
agtaaaaactgtgctggcgctaaattgaatccaaacattgttgggaaaccagctgcttgg
attgcagaacaagctggatttactgttccagaaggaaccaatattcttgctgcagaatgt
aaagaagtttcagaaaatgaacctttaacacgtgaaaaattatctccagtcattgctgtc
ttgaaatctgaatcacgtgaagacggtgttgaaaaagctcgtcaaatggttgaatttaat
ggacttggtcactcagctgccattcatacagcagatgcagagttggcaaaagaatttggt
actagaattcgtgctatccgtgtcatctggaattcaccttctacatttggtggtatcggt
gatgtttacaatgctttcttaccatcattgaccttaggatgtggttcttatggccgcaac
tcagttggtgataacgttagtgctgttaatctcttgaacatcaaaaaagtaggaagacgt
agaaataatatgcaatggtttaaagtcccttcaaaaacatacttcgaacgtgattcaatt
caataccttcaaaaatgccgtgacgttgaacgcgtgatgattgttactgaccatgccatg
gttgaacttggcttcttggatcgtatcattgaacaattggaccttcgtcgtaataaagtg
gtttaccaaatctttgcagatgttgaaccagatccagatattacaacagttatgaaaggt
actgaattaatgcgtaccttcaaaccagataccattattgcccttgggggtggttctcca
atggatgctgccaaagtaatgtggttattctacgagcaaccagaagttgatttccatgac
cttgtccaaaaattcatggatattcgtaaacgtgctttcaaattcccagaacttggtaag
aaaacaaaattcattgccattccaactacatctggtacaggttcagaggtaacaccattt
gctgttatttcagacaaggctaacaaccgtaagtacccaattgctgactactcattgaca
ccaactgtggcaattgttgacccagctttggtattgacagttccaggctttattgctgca
gatactggtatggacgttttgacacacgccacagaagcttatgtatctcaaatggctaac
gactttacagatggtttggcgcttcaagcaattaagattgtctttgaaactcttgaaaaa
tctgttaaagaagctgactttgagtcacgtgaaaaaatgcataatgcttcaacaatggca
ggtatggcatttgccaatgctttcctaggtatttctcactcaatggcacataagattggt
gcacaattccacactgttcatggtcgtaccaatgcaatcttgcttccatacgttatccgt
tacaacggtacacgtccagctaagactgcaacatggcctaagtacaattactaccgtgcg
gatgaaaaataccaagacattgcgaaattgttaggacttccagcttcaacaccagaagaa
gccgttgagtcttatgcgaaagctgtttatgaccttggttgccgtgttggcattaagatg
aacttcaaagatcaaggaattgatgagaacgagtggaaagaacattcacgtgccttggct
taccttgcttatgaagaccaatgttcgcctgctaacccacgcttaccaatggttgaccat
atgcaagaaatcattgaagatgcttactatggttacgcagagcgcccaggacgccgtaaa
taa

DBGET integrated database retrieval system