KEGG   Streptococcus dysgalactiae subsp. equisimilis ATCC 12394: SDE12394_00230Help
Entry
SDE12394_00230    CDS       T02017                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sdg  Streptococcus dysgalactiae subsp. equisimilis ATCC 12394
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sdg00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SDE12394_00230
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SDE12394_00230
  Lipid metabolism
   00071 Fatty acid degradation
    SDE12394_00230
  Amino acid metabolism
   00350 Tyrosine metabolism
    SDE12394_00230
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SDE12394_00230
   00626 Naphthalene degradation
    SDE12394_00230
Enzymes [BR:sdg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SDE12394_00230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
59020..60036
Genome map
AA seq 338 aa AA seqDB search
MKAVVVNEASTGVEVVDYEMPSIGHGEALVKVEYCGVCHTDLHVAHGDFGQVPGRILGHE
GIGIVEEIGEGVTSLQVGDRVSIAWFFEGCGHCEYCTTGRETLCRSVKNAGYSVDGGMSE
YAVVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKEAGAAPGQWIVIFGAGGLGNLAVQ
YAKKVFNAHVVAVDINNDKLELAKEVGADIVVNGKEIEDVPGYIQEKTGGAHGVVVTAVS
KVAFNQAIDSVRAGGTVVAVGLPSEYMELSIVKTVLDGIKVVGSLVGTRKDLEEAFAFGA
EGLVVPVVEKVPVDTAPDVFDEMERGLIQGRKVLDFTR
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgtagttgttaatgaagctagtacaggtgttgaagttgttgattatgaaatg
ccatcaattgggcacggagaagcacttgttaaagtcgaatactgtggtgtttgccataca
gatttgcacgtagcgcatggcgattttggacaagttcctgggcgtattctaggccatgaa
ggcattggtatcgtcgaagaaattggtgaaggtgtaacctcattacaagttggtgatcgt
gtctctattgcttggttctttgagggttgtggccattgtgaatattgtacgactggtcgt
gaaactctctgccgttctgttaaaaatgcaggttacagtgttgatggaggaatgagcgaa
tatgctgtcgtaacagctgattacgctgtaaaagtccctgaaggacttgatcctgcccaa
gcttcatcaatcacatgtgcgggtgtcactacttataaagctatcaaagaagcgggtgct
gctccaggtcaatggattgttatttttggtgctgggggtcttggaaacctagctgttcaa
tacgctaagaaagtctttaatgctcatgttgtcgcagtcgatatcaacaatgataaacta
gagttggctaaagaagtcggcgctgatattgtggttaatggtaaagaaattgaagatgtt
ccaggttatattcaggaaaaaacaggtggagcccatggtgtcgttgtaacagctgtttcc
aaagttgcctttaaccaagcgattgatagcgtccgtgcaggaggaactgttgtagctgta
ggtcttccatcagaatacatggaactgtctatcgtaaaaactgttttagatggtatcaaa
gtggtcggatcacttgtagggacacgtaaagacttggaagaagcctttgcctttggtgca
gaaggtctggttgttccggttgtcgaaaaagttccagttgatactgctccagatgtcttt
gatgaaatggaacgtggcttgattcaaggacgcaaagttttggattttactcgctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system