KEGG   Streptococcus dysgalactiae subsp. equisimilis ATCC 12394: SDE12394_00240Help
Entry
SDE12394_00240    CDS       T02017                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sdg  Streptococcus dysgalactiae subsp. equisimilis ATCC 12394
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sdg01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:sdg00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:sdg00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
60228..61712
Genome map
AA seq 494 aa AA seqDB search
MPMMYQSTRDQENKVTASQAILQGLAADGGLFTPVSFPKLALSFNKLKDKSYQAIAKLVL
SAFFDDFTEDEIEYCISSAYGDKFDTSLIAPVVSLTDSHHLELFHGTTIAFKDMALSILP
YLLTTAAKKQGVEQKIVILTATSGDTGKAAMAGFADVPGTEIIVFYPHAGVSKIQELQMT
TQVGENPHVVAIEGNFDDAQTDVKRMFNDPDLAQKLAARGMQLSSANSMNIGRLIPQVVY
YIYAYAQLVKAGQIEAGQNINITVPTGNFGNILAAYYAKKIGLPVATFICASNENRVLTD
FFTSGIYDKKRPFKITTSPSMDILVSSNLERLVFHLVGDNAEKTKCLMDALTRNGSYELQ
DSDEAIFSQFVAGFATEAETAAEIKRVFELDDYVMDPHTAVASAVYQNYRHETGDDTPTL
IASTASPYKFPGVVVEAITGEPVADDFEAVSQLKQLSHVVQPKAVIGLQNARVRHRLLVK
TADMQTAVENYLGL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgccgatgatgtaccaatcaacacgagatcaagagaataaagtgacggcaagtcaagct
attttgcaaggtttagctgcagatggaggattatttacacctgttagttttcctaagtta
gcattgtcatttaacaagcttaaagataaaagttatcaagccattgccaagctagtgcta
tccgctttttttgatgattttactgaagatgaaattgagtactgtatcagctcagcttat
ggtgataaatttgacacctctcttattgcaccagtagtttctctaacagactctcatcac
ttggaattgtttcacggaacaacgattgctttcaaagatatggctctgtctattttgcct
tatcttttgaccactgcagctaaaaagcaaggcgtggaacagaaaattgtgattttaaca
gctacttctggagatacaggtaaagctgctatggcaggttttgcagatgttcctggaaca
gaaattattgttttttatcctcacgcaggtgttagtaagattcaagaattacaaatgaca
actcaagttggagaaaatcctcacgttgttgccattgaggggaattttgatgatgctcaa
acagatgtgaaacgtatgtttaatgaccctgacttggctcagaaattagcagctcgcggg
atgcaactctcatctgcaaactccatgaatattggtcgtcttattccacaagtggtttat
tatatttatgcttatgctcaattggttaaagctggtcagattgaagcaggtcaaaacatt
aatattacggttcctactggtaattttgggaatattttagctgcttattatgccaagaaa
attggtctacctgtagcaacatttatttgtgcttctaatgagaacagggtcttaacggat
ttctttaccagtggtatctatgataaaaaacggcccttcaaaatcacaacaagtccttct
atggatattttggtatcatctaatttagaacgtcttgttttccatttagtaggggataat
gctgaaaaaaccaaatgtttaatggatgctctaacaagaaatggatcctacgaattacaa
gatagtgatgaggctattttttctcagtttgttgctggttttgccacagaagcagaaaca
gcggctgaaattaaacgagtatttgagttagacgattatgttatggatcctcataccgca
gttgcttcggcagtttatcaaaattatcgtcacgagacaggggatgacacaccgacactc
attgcctcaacagccagtccttataaatttccgggtgttgtagtagaagcaattactgga
gaaccggtcgccgatgactttgaagcagtgagtcaacttaagcagctttctcacgtggta
caaccaaaagctgtgataggattgcaaaacgcaagggttcggcaccgtctgcttgtgaaa
acggcagatatgcagacagctgttgaaaattatcttggtctgtaa

DBGET integrated database retrieval system