KEGG   Streptococcus dysgalactiae subsp. equisimilis ATCC 12394: SDE12394_00805Help
Entry
SDE12394_00805    CDS       T02017                                 

Definition
phosphoglycerate mutase family protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sdg  Streptococcus dysgalactiae subsp. equisimilis ATCC 12394
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sdg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SDE12394_00805
   01230 Biosynthesis of amino acids
    SDE12394_00805
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SDE12394_00805
  Energy metabolism
   00680 Methane metabolism
    SDE12394_00805
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SDE12394_00805
Enzymes [BR:sdg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SDE12394_00805
Exosome [BR:sdg04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SDE12394_00805
  Exosomal proteins of melanoma cells
   SDE12394_00805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
170918..171244
Genome map
AA seq 108 aa AA seqDB search
MRERKLSDEWVKDFNEIAQKQWEDFNFKLPNGESLKEVQERNIKALNHILSESKNQTVVI
GTHGTALSTIINDYKPEFRYEAFNAIKHVFPWVVRFEFEGEAFKEIRY
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
ttgcgagaacgtaaactttctgatgaatgggtcaaagatttcaatgaaatagctcaaaaa
cagtgggaggatttcaactttaaactaccaaatggtgaaagtttaaaagaagtccaagaa
agaaatattaaagcgctcaatcatattttatctgaatccaaaaaccaaacggtagtcatt
ggtacacatgggacggcattgtcaaccatcattaatgattataaaccagaatttaggtat
gaagcctttaatgctattaagcatgtctttccatgggtggtgagatttgaatttgagggg
gaagcatttaaggaaattaggtattag

DBGET integrated database retrieval system