KEGG   Streptococcus dysgalactiae subsp. equisimilis ATCC 12394: SDE12394_00850Help
Entry
SDE12394_00850    CDS       T02017                                 

Definition
phosphoglycerate mutase family protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sdg  Streptococcus dysgalactiae subsp. equisimilis ATCC 12394
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sdg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SDE12394_00850
   01230 Biosynthesis of amino acids
    SDE12394_00850
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SDE12394_00850
  Energy metabolism
   00680 Methane metabolism
    SDE12394_00850
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SDE12394_00850
Enzymes [BR:sdg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SDE12394_00850
Exosome [BR:sdg04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SDE12394_00850
  Exosomal proteins of melanoma cells
   SDE12394_00850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
177051..177611
Genome map
AA seq 186 aa AA seqDB search
MKTTFYFIRHAEPNYNNHDDVLRELTEKGIVSSKKLVNQFSSITIDKFYSSPYKRSIDTI
KPLADSKNKQITTIEGLRERKLSEGWIDNFNEVARKQWEDFNYKLPNGESLKEVQERNIL
AVNTILETSRNETVVIGTHGTALSTIINYYQEDFKYEMFNKYKHEFPWIVKFEFNESRKK
NIEIII
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccacattttattttatacgtcatgctgaacctaactacaataatcatgatgac
gttttaagagagttaactgaaaaagggatagtttcaagcaaaaaattagtaaatcagttc
tcatcaataactatagacaagttttattccagtccctacaaacgttcaatagacactatc
aaaccattagcagatagtaagaataaacaaatcacaacaattgagggattaagagagcga
aaactttctgaaggatggattgataattttaatgaagtggcacgaaaacaatgggaagac
tttaattataagttgccaaatggtgaaagtctaaaagaagttcaagaaagaaatattctt
gctgtaaataccattttagaaacttctagaaatgaaacagttgtaatagggacacatgga
acagccttatcaacaataattaattattatcaagaagactttaagtatgaaatgtttaat
aaatataaacatgagtttccatggattgtcaaatttgagttcaatgagagtcgaaagaaa
aatatagaaatcatcatataa

DBGET integrated database retrieval system