KEGG   Streptococcus dysgalactiae subsp. equisimilis ATCC 12394: SDE12394_01455Help
Entry
SDE12394_01455    CDS       T02017                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sdg  Streptococcus dysgalactiae subsp. equisimilis ATCC 12394
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:sdg01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:sdg01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sdg00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sdg00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:sdg00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
291074..291751
Genome map
AA seq 225 aa AA seqDB search
MKANLNRHFFIFNPKSYLYGEQLYQLAELADSLVTDDISIFMTAPYAELAELSKRTKHII
VTAQHMDRISPGRGMGKVLPESLVVNGVRAVFLNHAENPMTLTELVQALERAKALELITI
VCADSVAEARAIAVLNPNIILCEPTALIGTGQTSDLSYIQETNAAVKAINPDILMMQAAG
VSQADDVYQVIKAGADGTGCTSGIVKATSPKQMFQDMIAALQKAL
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcaaatcttaatcgtcatttctttatttttaatcccaagtcctacctatatggg
gaacagctctaccaattagcagagttggccgatagcttagtcactgatgatatcagtatc
tttatgacagcgccttacgccgaattagcagagcttagcaaacgcactaagcatatcatt
gtaactgctcaacacatggatcgcatatcgcctggccgtggtatggggaaggttttgcca
gaatctttagtggtaaatggtgtcagagcagtttttttaaaccatgccgaaaatccgatg
accttgacagagttagttcaagcccttgaaagggctaaggctttggaattaataacgatt
gtttgtgcagattctgttgcagaagccagagccattgccgttttaaaccccaatattatt
ttatgcgaacccaccgcgcttattggcactggccaaactagcgatttatcctatattcaa
gagaccaatgctgccgtcaaagctatcaatccagatattttgatgatgcaggctgcagga
gtaagtcaagccgatgatgtttaccaagtgatcaaggcaggtgcagatggcacaggctgt
actagtggtatcgtgaaagcaacatcacccaaacaaatgtttcaagacatgatagcagcc
ttacaaaaggctctctaa

DBGET integrated database retrieval system