KEGG   Streptococcus dysgalactiae subsp. equisimilis ATCC 12394: SDE12394_01455Help
Entry
SDE12394_01455    CDS       T02017                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sdg  Streptococcus dysgalactiae subsp. equisimilis ATCC 12394
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sdg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SDE12394_01455
   01230 Biosynthesis of amino acids
    SDE12394_01455
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SDE12394_01455
   00051 Fructose and mannose metabolism
    SDE12394_01455
   00562 Inositol phosphate metabolism
    SDE12394_01455
Enzymes [BR:sdg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SDE12394_01455
Exosome [BR:sdg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SDE12394_01455
  Exosomal proteins of bladder cancer cells
   SDE12394_01455
  Exosomal proteins of melanoma cells
   SDE12394_01455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
291074..291751
Genome map
AA seq 225 aa AA seqDB search
MKANLNRHFFIFNPKSYLYGEQLYQLAELADSLVTDDISIFMTAPYAELAELSKRTKHII
VTAQHMDRISPGRGMGKVLPESLVVNGVRAVFLNHAENPMTLTELVQALERAKALELITI
VCADSVAEARAIAVLNPNIILCEPTALIGTGQTSDLSYIQETNAAVKAINPDILMMQAAG
VSQADDVYQVIKAGADGTGCTSGIVKATSPKQMFQDMIAALQKAL
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcaaatcttaatcgtcatttctttatttttaatcccaagtcctacctatatggg
gaacagctctaccaattagcagagttggccgatagcttagtcactgatgatatcagtatc
tttatgacagcgccttacgccgaattagcagagcttagcaaacgcactaagcatatcatt
gtaactgctcaacacatggatcgcatatcgcctggccgtggtatggggaaggttttgcca
gaatctttagtggtaaatggtgtcagagcagtttttttaaaccatgccgaaaatccgatg
accttgacagagttagttcaagcccttgaaagggctaaggctttggaattaataacgatt
gtttgtgcagattctgttgcagaagccagagccattgccgttttaaaccccaatattatt
ttatgcgaacccaccgcgcttattggcactggccaaactagcgatttatcctatattcaa
gagaccaatgctgccgtcaaagctatcaatccagatattttgatgatgcaggctgcagga
gtaagtcaagccgatgatgtttaccaagtgatcaaggcaggtgcagatggcacaggctgt
actagtggtatcgtgaaagcaacatcacccaaacaaatgtttcaagacatgatagcagcc
ttacaaaaggctctctaa

DBGET integrated database retrieval system