KEGG   Streptococcus dysgalactiae subsp. equisimilis ATCC 12394: SDE12394_03375Help
Entry
SDE12394_03375    CDS       T02017                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sdg  Streptococcus dysgalactiae subsp. equisimilis ATCC 12394
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sdg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SDE12394_03375 (tpiA)
   01230 Biosynthesis of amino acids
    SDE12394_03375 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SDE12394_03375 (tpiA)
   00051 Fructose and mannose metabolism
    SDE12394_03375 (tpiA)
   00562 Inositol phosphate metabolism
    SDE12394_03375 (tpiA)
Enzymes [BR:sdg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SDE12394_03375 (tpiA)
Exosome [BR:sdg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SDE12394_03375 (tpiA)
  Exosomal proteins of bladder cancer cells
   SDE12394_03375 (tpiA)
  Exosomal proteins of melanoma cells
   SDE12394_03375 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
643595..644353
Genome map
AA seq 252 aa AA seqDB search
MSRKPIIAGNWKMNKTPQEAKAFVEAVASKLPSNDLVDVAVAAPAVDLVTTIEAAKDSVL
KVAAQNCYFENAGAFTGETSPKVLAEMGADYVVIGHSERRDYFHETDEDINKKAKAIFAN
GLTPILCCGESLETYEAGKAVEFVGAQVSAALAGLSEEQVASLVLAYEPIWAIGTGKSAT
QDDAQKMCKAVRDVVAADFGQEVADKVRVQYGGSVKPENVKDYMACPDVDGALVGGASLE
ADSFLALLDFLN
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccaattattgccggtaactggaaaatgaacaaaacccctcaagaagca
aaagcattcgttgaggctgtagcaagcaaattaccttcaaacgatcttgtagatgttgcg
gtggcagcgccagctgttgatttggtaacaactatcgaagctgctaaagattcagttctt
aaagttgctgcgcaaaactgctattttgaaaatgcaggagcctttactggtgaaacatca
ccaaaagtgcttgctgaaatgggagctgactacgttgttattggtcactcagaacgccgt
gattacttccatgaaacagatgaagacattaacaaaaaagcaaaagctatttttgcgaat
gggttaactccaatcctatgttgtggggaatctcttgaaacttacgaagcaggtaaagct
gttgagtttgttggtgctcaggtttctgcggctcttgcaggtctttctgaagagcaagtg
gcttcacttgttttagcttacgagccaatctgggcaatcggtactggtaaatcagctact
caagatgatgctcaaaaaatgtgtaaagctgtacgtgacgtggttgcagcagactttggg
caagaagttgctgataaagttcgcgttcaatacggtggttctgtaaaacctgaaaacgtt
aaagattacatggcttgtccagatgttgatggtgcccttgttggtggtgcatcattagaa
gctgatagcttcctcgctttgcttgattttcttaactaa

DBGET integrated database retrieval system