KEGG   Streptococcus dysgalactiae subsp. equisimilis ATCC 12394: SDE12394_03680Help
Entry
SDE12394_03680    CDS       T02017                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
sdg  Streptococcus dysgalactiae subsp. equisimilis ATCC 12394
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:sdg00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SDE12394_03680
Enzymes [BR:sdg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SDE12394_03680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
702415..704199
Genome map
AA seq 594 aa AA seqDB search
MEQFQIKEVFYLDGKPFKILSGAVHYFRIIPDSWYRVLYNLKALGFNTVETYVPWNLHEP
QKGHFCFEGLADLEAFLDLAQNLGLYAIVRPSPYICAEWEFGGLPAWLLEEPCRVRSRDK
VYLDHVAAYYDVLLPKLAKRQLDRGGNILMFQVENEYGSYGEDKEYLRALKDMMLARGIE
APLFTSDGAWESALEAGSLIEDNLLVTGNFGSKVSQNVASLRAFMSKHGKEWPMMCMEFW
LGWFNRWGEAIIRRDPQETVATIMDMIEQGSINLYMFCGGTNFGFMNGSSARLQKDLPQV
TSYDYDALLDEAGNPTLKYSLLQKALKATYPDLAFAEPLVSPSMAIGPIPLTQKVSLLTT
LKNVSGITFSFYPQSMEALNHSLGYMLYRSRLSKYGDQERLRIIDARDRVQVFLDDRRIQ
TQYQEDIGKDILMTLSKQRSQLTILVENMGRVSYGHKLTAPSQHKGLGRGVMSDLHFIGQ
WEQIPLDFQELSWLDFSQGWIEGLPSFYAYDFDCQVPTDTYIDLSQFGKGIALINGFNLG
RFWQKGPILSLYLPKGLLQKGKNRLVIFETEGQYSETLHLTKTPIYQTIKGEEG
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
gtggaacaatttcaaatcaaagaggtgttttaccttgatgggaaaccctttaaaatctta
tctggagcggttcattattttagaattatcccagacagttggtaccgtgtcttgtataac
ctaaaagctctggggtttaatacggttgagacttatgtgccttggaacttgcatgagcca
caaaaaggacatttctgctttgaaggtcttgcagacttagaagcctttctcgatttggct
cagaatcttggcttgtatgccattgtgagaccctctccttatatttgtgctgaatgggaa
tttggtggtttacctgcttggttactagaagagccatgtagagttcgttcacgagataag
gtctatttagaccatgtcgcagcttactatgatgtgcttctccccaaattagccaaacgt
caactggaccgcgggggtaatatcctcatgttccaagtagaaaatgaatatggctcttat
ggagaggacaaggagtatcttcgtgctttgaaagacatgatgctagcgcgaggcattgaa
gcaccgctttttacctctgatggggcttgggaaagtgccttggaggcaggaagcttaatt
gaagataatcttttagtaacaggaaacttcggttctaaggtttctcaaaatgtggccagc
cttagggcatttatgtctaaacatggcaaagaatggcccatgatgtgcatggaattttgg
ctgggttggtttaatcggtggggagaggcgattattcgacgggatcctcaagaaaccgta
gctactatcatggatatgattgaacaaggaagtatcaacctttatatgttctgtggcggt
accaattttgggttcatgaatggctcatcagccagactgcaaaaggacctcccgcaagtg
acctcttacgattacgatgccctgctggatgaagcaggaaatcctaccctcaaatacagt
cttttgcagaaagccttaaaagctacttacccagatttagcatttgcagaaccgctagtc
agcccgagcatggctatcggtcctatccctcttacacaaaaagtaagtttgttgacgact
ctcaaaaatgtaagcggtatcacttttagtttttacccgcaatctatggaagccttaaac
cattctttgggatatatgttgtatcgtagtaggctttccaagtacggtgatcaagaaagg
ttgcgaatcattgatgctagagatcgtgttcaggtattcttagatgataggcgaatccaa
acccagtatcaagaggacattggaaaggatattttgatgactctttcaaagcagaggtct
caactaaccattttagttgaaaacatgggacgagtcagctatggtcataagttgactgct
cctagtcaacacaaggggctggggcgtggcgtaatgagtgatttacattttatagggcag
tgggaacagattcctttagattttcaagaactgtcctggctggatttttcacagggttgg
attgaggggctcccgagtttttatgcctatgattttgactgccaagtgccaactgatact
tatattgacttaagtcaatttggtaaagggattgctctaatcaacggctttaatttgggt
agattttggcaaaaaggccctatcttgtccctctatttaccaaaaggattgttacagaaa
ggaaagaatcgtttggtgatttttgaaaccgaagggcaatatagtgagacccttcattta
accaagacccccatttatcaaactataaaaggagaagaaggatga

DBGET integrated database retrieval system