KEGG   Streptococcus dysgalactiae subsp. equisimilis ATCC 12394: SDE12394_03860Help
Entry
SDE12394_03860    CDS       T02017                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sdg  Streptococcus dysgalactiae subsp. equisimilis ATCC 12394
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sdg00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
742698..744578
Genome map
AA seq 626 aa AA seqDB search
MDNELALYTFGTGENNQLQDYLGVHRVDIDHKTAYVFRVWAPNAEEVSLIGDFTDWKANP
LSMFRHEAGIWEVTTPLAKEGDIYKYLVKRQGGHVVEKIDPLAVLFEARPGTGAVVKTLP
DKRWRDSLWMGRRKRFGFRERPVNIYEVHANSWKKDETGKPYDMSRLKEELIPYLKKMHY
THVEFLPVMTHPLDMSWGYQLMGYFAFDSTFGSPEDFQDFVEACHLNNIGVIVDWVPGHF
TQNDDALAYFDGTPTFEYQDHHRARNYGWGALNFDLGKNQVQSFLISSALFWLETYHIDG
IRVDAVSNMLYLDYDQGPWTPNIHGGNQNLEGVAFLQKLNRVIKEKHPDVMMIAEESSSA
TPITSPIEEGGLGFDYKWNMGWMNDILRFYEEDPYYRQFDFNLLTFSFVYCFNERYILPF
SHDEVVHGKKSMMHKMWGDRYNQFAGLRNLYTYQMCHPGKKLLFMGSEFGQFLEWKYNDQ
LEWHDLEDRFNAKLQRFTAELNQFYKDHNMLWQNDETYDSIDIIDADNKQESVLSFCRLN
NKGELLLCVFNMTPVERPDFTIGVPVAGIYEEVFNTEMEAYGGVWKEHNPITKTVQAQWK
EYHQTLSFTLPALGASIWKVKRRQKD
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atggacaatgagttagcgctttacacatttggcaccggggagaataaccagttgcaagat
tacttgggtgttcaccgggttgacatagatcataaaactgcttacgtcttcagggtgtgg
gctccgaatgcagaagaagtgagtctaataggcgattttactgactggaaagctaaccct
ttaagcatgtttaggcatgaggcaggtatttgggaggtgaccacaccattagctaaagaa
ggggatatttacaaatacctggttaaacggcaaggtggtcacgttgtcgagaaaattgat
cctcttgctgtcttgtttgaagctaggccagggacaggagctgttgttaaaacattacca
gataaaagatggcgagatagtttgtggatggggcgaaggaaacgctttggatttagagaa
agacctgttaacatctatgaggtccacgctaattcttggaagaaggatgaaactggaaag
ccatatgacatgtctcgcttgaaagaagagctgattccttatctcaaaaagatgcattat
actcatgtagaatttcttcctgtcatgacgcatcctttggacatgagctggggataccaa
ctgatggggtattttgcttttgattcgacctttggtagcccagaggatttccaggacttt
gtcgaagcttgtcaccttaataatattggcgttattgtcgactgggtaccagggcatttt
acacaaaatgatgatgctttagcttactttgatggaacgccaacctttgagtatcaagac
catcatcgagcgcggaattatggctggggggctttgaactttgatttaggtaaaaatcag
gtacagtctttcttaatctccagtgccttattttggttagaaacttatcatattgatggt
atccgggtagatgcggttagcaacatgttgtatttagattatgatcaagggccgtggaca
cctaatattcatggtggaaaccaaaatcttgaaggggttgcctttcttcaaaaattgaat
cgggtgataaaagaaaaacacccagatgtcatgatgatcgcagaggaatcctcttcagca
acaccgattaccagccctattgaagagggtggactagggtttgattacaaatggaacatg
ggttggatgaatgatattttgaggttctatgaagaagacccttattaccggcaatttgat
ttcaacctcttgacttttagttttgtgtattgtttcaatgaacgctatattctgccattt
tctcatgacgaagtagtgcatggtaagaagagcatgatgcataagatgtggggagatcgc
tataatcaatttgcaggcttgcgaaatctctacacttatcaaatgtgtcatccaggtaaa
aaattactatttatgggctctgaatttggtcaatttttagagtggaagtacaatgatcaa
ctagaatggcatgatttggaagatcgctttaatgccaaactacaacggtttacagctgag
ttaaatcagttttataaagatcataacatgctttggcaaaatgatgagacgtatgacagt
attgatatcattgatgctgataacaaacaagaatcggttttatctttctgtcgcctcaac
aataaaggggaactgttgttgtgcgtctttaacatgacgcctgttgaacgaccagatttt
actataggtgttccagtcgcaggaatctatgaggaagttttcaatactgaaatggaagcg
tatggaggtgtttggaaagaacacaatcctatcactaaaacagtacaagcacaatggaaa
gaatatcatcaaaccctctctttcactttaccagcattgggagcaagtatctggaaggtt
aagcgtcgtcaaaaagactag

DBGET integrated database retrieval system