KEGG   Streptococcus dysgalactiae subsp. equisimilis ATCC 12394: SDE12394_04525Help
Entry
SDE12394_04525    CDS       T02017                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
sdg  Streptococcus dysgalactiae subsp. equisimilis ATCC 12394
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sdg00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:sdg00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
877727..878224
Genome map
AA seq 165 aa AA seqDB search
MTKEMIAIWAEDEAGLIGVDGKLPWYLPRELQHFKETTLNQAILMGRVTFDGMNRRLLPN
RQTLVMTRDVNYQVDGVLTMTSVEEVLDWYHAQEKTLYVIGGSKVLEAFDGYFNRVIKTV
VHHQFEGDTYRPKLDLSRFREESQTFYPKDANNPYDFTVTVLKHQ
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaggaaatgattgctatctgggcagaagatgaagcaggtcttatcggggttgat
ggcaagctaccatggtatctgccaagagagctgcaacattttaaagaaacaactttgaat
caagctattttaatggggagagtaacctttgatggcatgaatcgtaggctgcttcctaat
cgtcaaacccttgtgatgacaagagatgtaaactatcaagtagatggggtattgaccatg
actagtgttgaggaagtgctggattggtatcatgcacaggaaaaaacactttacgttatt
ggtggaagcaaggttttagaagcctttgacggttattttaatcgtgtgattaaaacagtg
gttcatcaccaatttgaaggggatacctaccgaccaaaacttgacttaagtcgttttagg
gaagaaagccaaaccttctatccaaaggatgcaaacaatccttacgattttacagtgacg
gttttaaaacaccaatag

DBGET integrated database retrieval system