KEGG   Streptococcus dysgalactiae subsp. equisimilis ATCC 12394: SDE12394_04525Help
Entry
SDE12394_04525    CDS       T02017                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
sdg  Streptococcus dysgalactiae subsp. equisimilis ATCC 12394
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SDE12394_04525
   00670 One carbon pool by folate
    SDE12394_04525
Enzymes [BR:sdg01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     SDE12394_04525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
877727..878224
Genome map
AA seq 165 aa AA seqDB search
MTKEMIAIWAEDEAGLIGVDGKLPWYLPRELQHFKETTLNQAILMGRVTFDGMNRRLLPN
RQTLVMTRDVNYQVDGVLTMTSVEEVLDWYHAQEKTLYVIGGSKVLEAFDGYFNRVIKTV
VHHQFEGDTYRPKLDLSRFREESQTFYPKDANNPYDFTVTVLKHQ
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaggaaatgattgctatctgggcagaagatgaagcaggtcttatcggggttgat
ggcaagctaccatggtatctgccaagagagctgcaacattttaaagaaacaactttgaat
caagctattttaatggggagagtaacctttgatggcatgaatcgtaggctgcttcctaat
cgtcaaacccttgtgatgacaagagatgtaaactatcaagtagatggggtattgaccatg
actagtgttgaggaagtgctggattggtatcatgcacaggaaaaaacactttacgttatt
ggtggaagcaaggttttagaagcctttgacggttattttaatcgtgtgattaaaacagtg
gttcatcaccaatttgaaggggatacctaccgaccaaaacttgacttaagtcgttttagg
gaagaaagccaaaccttctatccaaaggatgcaaacaatccttacgattttacagtgacg
gttttaaaacaccaatag

DBGET integrated database retrieval system