KEGG   Streptococcus dysgalactiae subsp. equisimilis ATCC 12394: SDE12394_04875Help
Entry
SDE12394_04875    CDS       T02017                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
sdg  Streptococcus dysgalactiae subsp. equisimilis ATCC 12394
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SDE12394_04875
Enzymes [BR:sdg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SDE12394_04875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
943597..944397
Genome map
AA seq 266 aa AA seqDB search
MKIGKFVIDGNAAIMGILNVTPDSFSDGGSYTTVQKALQQVDQLIAGGAKIIDVGGESTR
PGYQFVSAADEIERVVPMIKAIKAKYDVLISIDTYKTETARAALEAGADILNDVWAGLYD
GEMLALAAEYDVPIILMHNQKEEVYQDVTQDVCDFLSARAQAAIDAGVPKDNIWIDPGFG
FAKSVQHNMELLKGLDHVCQLGYPVLFGISRKRVVDALLGGNTKAKERDGATAALSAYAL
GKGCQLVRVHDVKANQEIVAVLSQLM
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgggaaatttgtgattgacggcaacgctgctattatgggaattttaaatgtg
actcccgattccttttccgatggtggttcatacacgacagtacaaaaagccttacaacag
gtagatcagctaattgctggtggggccaaaattattgatgttggcggtgaatccactcga
ccaggttaccaatttgtgagcgctgctgatgaaattgagcgtgtcgttcccatgattaaa
gccattaaagcaaaatatgatgtgttaatcagtattgatacctacaaaacagaaaccgca
agagcagctttagaagctggtgctgacattttaaatgatgtctgggcaggtttatacgat
ggggaaatgcttgctctagcagcagagtatgatgtgcctattatcttgatgcataaccaa
aaagaagaagtctatcaagatgtaacacaagatgtttgtgattttttgagtgctagagct
caggcagccatagatgctggagtaccaaaagacaatatttggattgatccaggatttgga
tttgccaaatctgttcaacacaatatggagttattaaaaggattggatcatgtttgtcag
ttgggttatcctgtcttgtttggtatttcgagaaagcgtgttgtagatgccttgttaggc
ggcaacaccaaagctaaagagcgagacggagcgacagcagccttatctgcttatgctctt
ggaaaaggctgtcagctggtacgcgtacacgatgtcaaggctaatcaagaaattgtggct
gttttgagtcagttgatgtga

DBGET integrated database retrieval system