KEGG   Streptococcus dysgalactiae subsp. equisimilis ATCC 12394: SDE12394_04885Help
Entry
SDE12394_04885    CDS       T02017                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sdg  Streptococcus dysgalactiae subsp. equisimilis ATCC 12394
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SDE12394_04885
Enzymes [BR:sdg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SDE12394_04885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
944761..945261
Genome map
AA seq 166 aa AA seqDB search
MTIVYLSLGTNMGDREEYLSQAVQSLAKIPNIHLLAQSSIYETAAWGKTDQADFLNMACQ
LDTQLTAADFLKETQAIEQSLGRVRHEKWGPRTIDIDILLFGEEVYDTKELKVPHPYMTE
RAFVLIPLLELQPDLKLPPNHKFLRDYLAALDTSDITLFSARQTES
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgaccattgtttatttaagtttagggaccaatatgggagaccgagaagagtacttgagt
caagctgttcagtcccttgctaagattcctaacatccatttactagcccaatcgtctatt
tatgaaacggctgcttggggtaagacagatcaagctgacttccttaacatggcctgtcaa
ttagatacacaattaaccgcggctgatttcttaaaagaaacacaagctattgagcaatct
cttggtcgtgtgaggcatgaaaaatggggaccaagaaccattgacattgatatcttgcta
tttggagaagaggtttatgacacaaaggaattgaaagtgccacacccatatatgactgag
cgtgcttttgttttaatccccttattggaattgcagccagatttaaaattgcctcctaat
cataagtttttaagggattatcttgcagctttagacacctcagacatcacgcttttttca
gctcgacagacagagtcttag

DBGET integrated database retrieval system