KEGG   Streptococcus dysgalactiae subsp. equisimilis ATCC 12394: SDE12394_06085Help
Entry
SDE12394_06085    CDS       T02017                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sdg  Streptococcus dysgalactiae subsp. equisimilis ATCC 12394
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:sdg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SDE12394_06085
   01230 Biosynthesis of amino acids
    SDE12394_06085
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SDE12394_06085
   00030 Pentose phosphate pathway
    SDE12394_06085
   00051 Fructose and mannose metabolism
    SDE12394_06085
   00052 Galactose metabolism
    SDE12394_06085
  Energy metabolism
   00680 Methane metabolism
    SDE12394_06085
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SDE12394_06085
Enzymes [BR:sdg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SDE12394_06085
Protein phosphatases and associated proteins [BR:sdg01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SDE12394_06085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1172513..1173526)
Genome map
AA seq 337 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVYGINRGYAGMVDGDIFPLGSKEVGDK
ISRGGTFLYSARYPEFAQLEGQLAGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GIPGTIDNDIAGTDYTIGFDTAVNTAVEAIDKLRDTSSSHGRTFVVEVMGRNAGDIALWA
GIASGADQIIVPEEEFDIEKVVSTIQYDFEHKGKNHHIIVLAEGVMSGEAFAQKLKEAGD
KSDLRVTNLGHILRGGSPTARDRVIASWMGSHAVELLKEGKGGLAVGIHNEELVESPILG
TAEEGALFSLTEEGKIIVNNPHKARLDFAALNRSLSQ
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttaaccagtggcggtgacgctcctggtatgaatgctgctatt
cgtgcagtcgttcgtaaagcaatctcagaaggaatggaagtttatggtattaaccgtggc
tacgcaggcatggttgacggtgatattttcccattaggttcaaaagaagtgggagataaa
atttcacgtggtgggactttcttatactcagctcgttatccagagtttgctcaacttgaa
ggtcaattggctggtattgagcaacttaaaaaacatggtattgaaggtgttgttgttatc
ggtggagatggttcttatcatggcgctatgcgcttgacagagcacggcttcccagcggta
ggtatcccaggaacaatcgataacgatattgcgggaactgactacactatcggatttgat
acagcagttaacacagcagttgaagctattgataaacttcgtgacacctcatcaagccac
ggacgtacttttgtggttgaagtgatgggtcgcaatgcgggtgatattgctctttgggca
ggtattgctagtggtgctgatcaaatcattgttccagaagaagagtttgatattgaaaaa
gtggtatcaacaatccaatatgattttgaacacaaaggtaaaaatcaccacatcatcgtc
ttagctgaaggtgttatgagtggtgaagcttttgctcaaaaacttaaagaagctggcgat
aagagtgaccttcgtgtgacaaatcttggccacattcttcgtggaggttcaccaactgct
cgtgaccgtgtcattgcttcttggatgggttcacatgctgttgagctacttaaagaaggc
aaaggtggcttggctgttggtattcataatgaagaacttgttgaaagcccaatccttggt
actgcagaagaaggtgctttgttcagcttgactgaagaaggcaagattattgttaataat
ccacacaaagctcgtttagactttgcagctttgaaccgttcattgtcacaataa

DBGET integrated database retrieval system