KEGG   Streptococcus dysgalactiae subsp. equisimilis ATCC 12394: SDE12394_06790Help
Entry
SDE12394_06790    CDS       T02017                                 

Definition
putative 4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sdg  Streptococcus dysgalactiae subsp. equisimilis ATCC 12394
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SDE12394_06790
Enzymes [BR:sdg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     SDE12394_06790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1306290..1307786)
Genome map
AA seq 498 aa AA seqDB search
MNKRASGILMHISSLPGKTGIGTFGKAAFDFVDFLKETKQTYWQILPLTTTSYGDSPYQS
FSAIAGNTHFIDLELLVADGYLQEADLVGVDFGSDPEVVDYAQIFQARRPLLEKAVQAFL
ATKEAVKELAAFEAEASWLGDFAEFMSLKEHFQNKALQEWDDSAIVKREEAALHHYRELL
AESIHYHKVCQYFFYQQWLALKAYANDNGIEIIGDMPIYVSADSVEVWTMPDLFKVDEDK
NPLFIAGVPADGFSEDGQLWGNPIYNWAAHEASNFAWWIYRIQESFKLYDYLRIDHFKGF
SDFWEIPGGDTTARNGHWESAPGLALFAAVREALGELPIIAENLGYIDEKAEQLLASTAF
PGMKILEFGLFDITSQSSDLPHHYDRNCVVYTGTHDNEVVNGWYANLTEEQVTFVNDYLH
KGADESITQAMLRTIFATVSDTAILCMQDLLDKGAESRMNMPNTVGGNWQWRMLEGDITE
EHKAYLTHLTELYDRVNH
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacgtgcaagcggtatcttaatgcatattagttcccttcctggtaagaccgga
attggaactttcgggaaggcagcttttgactttgttgatttcctaaaagaaaccaaacaa
acttattggcagattctacctttaacaacgacaagttatggggattcaccttaccaatca
ttttcagctattgcaggtaatactcattttatcgatcttgaattacttgttgcagacggc
tacttgcaggaagctgatctcgttggcgttgattttggttctgaccctgaggtggttgac
tatgctcagatttttcaggcaagacgccccttattagaaaaagcggtccaagcctttctt
gcaactaaagaagccgtcaaagaattggcagcttttgaagcagaagcgagttggttgggt
gactttgccgagttcatgtcattgaaagaacactttcaaaataaggccctacaagaatgg
gatgacagtgcaattgtgaaacgcgaagaagcagccttgcatcattaccgtgaattactt
gctgaaagtattcactaccataaagtctgtcaatatttcttctaccaacaatggttggcc
ttaaaagcgtatgccaatgataatggcattgagattattggtgatatgccaatctatgtt
tctgcagatagtgtggaagtttggacaatgccagacttgtttaaagtggacgaggataaa
aacccactctttatcgctggagttcctgcagatggctttagtgaagatggtcaactttgg
ggcaatccgatttacaattgggcagcccatgaagcatccaactttgcttggtggatttac
cgtattcaagaaagtttcaaattatatgactatttgagaattgatcactttaaaggcttt
tcagatttctgggaaattcctggtggcgacacaactgctcgaaatggacattgggaatca
gctccgggacttgctttgtttgcggcagttcgtgaggctttaggagaactgcctatcatc
gcagaaaaccttggttatattgatgaaaaggcagagcagctattagcctcaacagccttt
ccaggaatgaagattttagaatttggcctttttgacattaccagccaaagcagtgattta
ccacatcattatgatcgtaactgtgtggtttatactggtacgcatgataacgaagtggtt
aatggttggtatgcaaaccttacggaagaacaagttacttttgtgaatgactacctccac
aaaggtgcagatgaaagtattacacaagccatgttgcgcacgatttttgcaacagttagt
gatacggctatcttgtgcatgcaagacttgcttgataagggggcagaaagccgcatgaac
atgccaaataccgtgggtggcaattggcaatggcggatgcttgaaggagatatcaccgaa
gagcacaaagcctacttgacacatttgacagaattatacgatcgcgtcaatcattaa

DBGET integrated database retrieval system