KEGG   Streptococcus dysgalactiae subsp. equisimilis ATCC 12394: SDE12394_07290Help
Entry
SDE12394_07290    CDS       T02017                                 

Definition
glycosyl hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sdg  Streptococcus dysgalactiae subsp. equisimilis ATCC 12394
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sdg00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SDE12394_07290
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    SDE12394_07290
Enzymes [BR:sdg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SDE12394_07290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1412074..1413864)
Genome map
AA seq 596 aa AA seqDB search
MTHLVDLRKKPYHLDDQAIAWVEETIASMSLEEKIGQLFVNMGASRTEEYLTQVLNDYKI
AAVRYNKGMADEVWEQNYILQTKSKIPLLIAANTEAGGDGAVNDGTKVGDEIKVAATNDP
KYAYEMGRIAGIEAAAVGCNASFAPIVDLTRNWRNPIIASRNWGSNVDQIITLSKEYMRG
IMEHGIMPFAKHFPGDGIDERDHHLSFASNPMTKDEWMSTFGRIYGELAEAGLPGIMAGH
IHLPNVEKELHPERELDDMLPASLNKTLLDELLRGELGYNGAIVTDASHMVAMTASMPRR
LMLPTAVEAGCDLFLFFNDPDEDLQWMKEGYEAGILTEERLHDALCRTLGLKARLGLHLY
EGRREEIMLPKEEAMTLINTKEAQAIADEVADKAITLVKDKQKDIFPVTPERYKRILIVN
VEGHKGGFGAMIAGQKKRASDVVKELLEARGHDVTVWESTEERIMQLPESERAAAIANVY
AQKQPISNLTDHYDLILNLVDVNSGGTVQRIVWPAAKGTPDQPFYVHEIPTIVVSVQHAF
ALADMPQVGTYINAYDGKDNTMKALVEKLAGESNFTGVSPVDAFCGLIDTHLWREY
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgacacatttagtagatttacgcaaaaaaccttatcaccttgatgaccaagccatcgct
tgggtagaagaaaccattgcctccatgtccttggaggagaaaattgggcagttatttgtt
aacatgggagctagtcgtaccgaagagtatttgacccaagtgcttaatgattataaaatt
gcggcggttcgctacaataaaggcatggccgacgaagtttgggaacaaaactacatctta
caaaccaaatcaaaaattccactcttaattgctgctaacaccgaagcaggtggcgatggc
gcagttaatgatggcacaaaggttggggacgagattaaggttgccgcaacaaatgatcca
aagtacgcttacgaaatggggcgcattgcagggattgaagcagcagcggttggctgtaac
gcttcctttgctcctattgttgacctgacacgcaactggcgcaacccaattatcgctagc
cgtaactggggttcaaatgtggaccaaatcattaccttgtctaaagagtacatgagaggg
attatggagcatggcattatgccatttgccaaacatttcccaggggacgggattgatgaa
cgtgaccatcacctctcttttgcatcaaacccgatgacaaaagacgagtggatgtctacc
ttcggtcgtatttatggtgaactagctgaagctggtcttcctggtattatggcaggtcat
atccatttgccaaatgttgagaaagagttgcatcctgaacgtgagttggatgacatgcta
ccagcttcactcaacaaaacgttgttggatgaattgctgcgcggggagcttggttacaat
ggggctattgtgacagatgcttctcacatggttgccatgacagcttctatgccacgtcgt
ttgatgctgccaacggctgtggaagcgggatgtgacctcttcttattctttaatgatcca
gatgaagacttgcaatggatgaaagaaggctatgaggctggtattttgacagaagaacga
ctccatgatgccctttgccgtacgcttggtttgaaagcacgtctaggacttcatttatat
gaaggtcgtcgtgaagagattatgctaccaaaagaagaagcgatgacactgattaatacc
aaagaagcgcaagccattgctgacgaggtagctgacaaagccattactcttgttaaagat
aagcaaaaggatattttcccagtcacgcctgaacgctacaaacgcattttgattgtcaat
gtagaaggtcacaaaggtggttttggtgcgatgattgcagggcagaaaaaacgagcatcc
gatgtggttaaagaattgctagaagcgcgtggtcatgacgtcacggtgtgggagtcaacg
gaagaacgtatcatgcaattgccggaaagcgaacgtgccgcagccattgctaatgtttat
gcccaaaaacaacccatttccaatttgacagaccattacgatttaatccttaaccttgtt
gatgtcaactctggtggaacagttcagcgtattgtctggccagcagccaaggggacaccg
gatcagccattttatgtgcatgaaatcccaacaattgtggtatcagttcaacatgccttt
gccctagcagacatgccacaagtagggacttatatcaatgcttacgacggtaaggacaat
accatgaaagctttggtggagaaattggctggcgaatccaacttcaccggtgtttcacca
gtagatgctttctgtggccttattgacacgcatttgtggcgagagtactaa

DBGET integrated database retrieval system