KEGG   Streptococcus dysgalactiae subsp. equisimilis ATCC 12394: SDE12394_07625Help
Entry
SDE12394_07625    CDS       T02017                                 

Gene name
recR
Definition
(RefSeq) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
sdg  Streptococcus dysgalactiae subsp. equisimilis ATCC 12394
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sdg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SDE12394_07625 (recR)
DNA repair and recombination proteins [BR:sdg03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SDE12394_07625 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1488397..1488993)
Genome map
AA seq 198 aa AA seqDB search
MFYPTPIAKLIESYSKLPGIGVKTATRLAFYTIGMSDEAVNDFAKNLLAAKRELTYCSIC
GNLTDDDPCSICTDTSRDQTTILVVEDAKDVSAMEKIQEYHGYYHVLHGLISPMNGVGPD
DINLKSLITRLMDGKVTEVIIATNATADGEATSMYISRVLKPAGIKVTRLARGLAVGSDI
EYADEVTLLRAIENRTEL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgttttacccaacccctattgcaaaattaatcgaaagttattccaagctcccaggaatt
ggggtaaaaacggcaactagacttgccttttacacaattggaatgtctgacgaggctgtc
aatgactttgctaaaaatttattggcagctaaaagagaattaacctattgttccatttgt
ggcaacctgacagatgatgatccttgttctatctgcacagatacaagtcgtgaccagaca
acgattcttgtggtggaagatgctaaagatgtttctgctatggaaaaaattcaagagtat
catggttattaccatgtgctgcatggtttaatttcaccgatgaatggtgttggtccggat
gatatcaatctaaaaagtttaattactcgtttaatggacggtaaagtgactgaagttatc
atagcgaccaatgccacagctgatggcgaagcaacatctatgtatatctcacgggtcttg
aaaccagcaggaatcaaagttacccgcttagcaagagggctcgcagtggggtcagatatt
gaatacgcagatgaagtcaccttgttaagagctattgaaaaccgcacagaactttaa

DBGET integrated database retrieval system