KEGG   Streptococcus dysgalactiae subsp. equisimilis ATCC 12394: SDE12394_07910Help
Entry
SDE12394_07910    CDS       T02017                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sdg  Streptococcus dysgalactiae subsp. equisimilis ATCC 12394
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sdg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SDE12394_07910
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SDE12394_07910
   00052 Galactose metabolism
    SDE12394_07910
   00500 Starch and sucrose metabolism
    SDE12394_07910
   00520 Amino sugar and nucleotide sugar metabolism
    SDE12394_07910
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SDE12394_07910
   00524 Butirosin and neomycin biosynthesis
    SDE12394_07910
Enzymes [BR:sdg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SDE12394_07910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1543575..1544546)
Genome map
AA seq 323 aa AA seqDB search
MSQKLLGIDLGGTTVKFGILTAAGEVQEKWAIETNILEGGKHIVPDIIASIKHRLELYGL
SSADFIGIGMGSPGAVDRTANTVTGAFNLNWKETQEVGSIIEKELGIPFAIDNDANVAAL
GERWVGAGENNPDVVFMTLGTGVGGGIIADGNLIHGVAGAGGEIGHMIVEPENGFACTCG
SHGCLETVASATGVVKVARLLAEAYEGDSTIKAAIDNGDNVTSKDIFMAAEAGDSFADSV
VEKVGYYLGLASANISNILNPDSVVIGGGVSAAGEFLRSRIEKYFVTFTFPQVRYSTKIK
IAELGNDAGIIGAASLARQFITE
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaagttactggggattgatttaggtggaaccactgttaaatttggtatttta
acagcagcaggagaagtccaagaaaaatgggcgattgagactaatattttagaagggggc
aagcacattgtccctgatatcatcgcttccatcaaacaccgcttggaattatatggtcta
agcagtgcagattttattggtatcggtatggggtcaccaggggctgttgaccgtactgct
aatacagtgaccggagcattcaaccttaactggaaagaaactcaggaagtcggttccatt
attgaaaaagaattaggtattccttttgccattgataatgatgccaatgtggctgctctt
ggtgagcgttgggttggagctggcgaaaacaatcctgatgttgttttcatgacactagga
actggtgtcggtggggggattatcgccgatggtaacctgattcatggtgttgcaggagca
ggtggtgaaatcggccacatgattgttgaaccggaaaatggctttgcttgtacttgtggc
tcacacggctgtttggaaacagtagcctcagcaacaggtgttgtcaaggtagcacgttta
ttggcagaagcttatgaaggagattctactattaaagccgccattgataatggggacaat
gtcaccagcaaagatattttcatggccgctgaagcaggagattcctttgcagattctgtt
gtggaaaaggttggttactaccttggtcttgcgtcagcaaatatttccaatatcttgaat
ccagactcagtggttatcggtgggggtgtgtcagcagcaggagaatttctacgctcacgt
attgaaaaatactttgtgaccttcaccttcccacaagtgaggtattcaactaaaattaag
attgcagagcttggcaatgatgctggaattatcggtgcagctagccttgctcgacaattt
atcacagagtag

DBGET integrated database retrieval system