KEGG   Streptococcus dysgalactiae subsp. equisimilis ATCC 12394: SDE12394_07980Help
Entry
SDE12394_07980    CDS       T02017                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sdg  Streptococcus dysgalactiae subsp. equisimilis ATCC 12394
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sdg00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SDE12394_07980
Enzymes [BR:sdg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SDE12394_07980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1555905..1556816)
Genome map
AA seq 303 aa AA seqDB search
MSKIVIVGSISMDLVMKTNRIAQEGETVFGDSFAMVPGGKGANQAVAVGRLAAQKDQINM
LGAVGEDSFDHLLLQNLADNGLNVDFVGTVPSSSGIAQITIFNHDNRIIYCPGANGEVDT
TLWEKEWDLLEAADLVILQNEIPHQANLGIAQFCHDKGIKVLYNPAPARETDKEMLDLVT
YFTPNQHEVQELFPDKELDTILEAYPNRLIVTLGTKGSTYFDGQVIQLIPAIKTEAIDTT
GAGDTFNGAFGFAVSKGLDMRESLKFATLASHLSVQQFGAQGGMPTLSEMKEHDAYEKAW
DFE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagattgttattgtcggcagtatctccatggaccttgtgatgaagaccaatcgg
attgcgcaagagggagagacggtttttggagatagctttgctatggttcctggtggtaaa
ggggctaaccaagctgttgcagttggtcgcttagccgcccaaaaagatcagattaacatg
ctgggagctgtgggcgaggattcctttgaccatctcttattacaaaatttagcagataac
ggtcttaacgtggactttgtgggaacggtaccatcatcgtctggtattgctcaaatcacc
atttttaaccatgacaaccgaattatctattgtcccggagcgaatggagaggttgacaca
actctttgggaaaaagaatgggatttattagaagcagctgatttggttattcttcaaaat
gaaatcccgcaccaagctaatttgggcatagctcaattttgtcatgataaaggcatcaag
gtgctctataacccagcccctgcgagagagacagataaagagatgctagacttggtcacc
tatttcacaccaaaccaacatgaagttcaagaactcttcccagataaagaattggacact
attcttgaggcatatccaaatcgtcttatcgttactttgggaactaagggatctacttac
tttgatgggcaagttattcaactgattccagccattaagactgaagctattgatacgaca
ggtgctggagatacctttaacggagcctttggttttgctgtttcaaaaggattagacatg
cgtgaatctttaaaatttgcgaccttggcctcacacttatctgttcaacaatttggtgcc
caaggtggcatgccaacattatcagaaatgaaggagcacgacgcttatgaaaaagcatgg
gattttgaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system