KEGG   Streptococcus dysgalactiae subsp. equisimilis ATCC 12394: SDE12394_08520Help
Entry
SDE12394_08520    CDS       T02017                                 

Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
sdg  Streptococcus dysgalactiae subsp. equisimilis ATCC 12394
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:sdg00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:sdg00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1675647..1676114
Genome map
AA seq 155 aa AA seqDB search
MTHTKEVAFITGAASGIGKQIGETFLKEGKTVVFSDINKEKLDEVVAEYTNEGYDAFSVV
CDVTKEEAINSAIDTVVEKYGRLDILVNNAGLQHVAMIEDFPTEKFEFMIKIMLTAPFIA
IKRAFPTMKAQKHGRIINMASINGVIGFAGKSAYL
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgacacatactaaagaagttgcatttatcactggtgctgcaagcggaatcggaaaacaa
atcggggaaaccttcttaaaagaaggtaaaacggttgtcttctcagatattaataaagaa
aagctagatgaggtggttgcagaatacaccaatgaaggttacgatgcctttagcgttgtg
tgcgatgttactaaagaagaagctatcaactctgccattgatactgttgttgaaaaatat
ggacgtcttgatattcttgttaacaatgcaggccttcaacacgttgcaatgattgaagac
tttccaactgaaaaatttgagtttatgattaaaatcatgttgacagcaccatttattgct
attaagcgtgccttcccaacaatgaaagctcaaaaacatggacgtatcattaatatggca
tccattaatggtgtcatcggctttgctggaaaatcagcttatttgtag

DBGET integrated database retrieval system