KEGG   Streptococcus dysgalactiae subsp. equisimilis ATCC 12394: SDE12394_08650Help
Entry
SDE12394_08650    CDS       T02017                                 

Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
sdg  Streptococcus dysgalactiae subsp. equisimilis ATCC 12394
Pathway
sdg00330  Arginine and proline metabolism
sdg00332  Carbapenem biosynthesis
sdg01100  Metabolic pathways
sdg01130  Biosynthesis of antibiotics
sdg01230  Biosynthesis of amino acids
Module
sdg_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sdg00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SDE12394_08650
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    SDE12394_08650
Enzymes [BR:sdg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SDE12394_08650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase
Motif
Other DBs
NCBI-ProteinID: ADX25168
Position
complement(1702347..1703168)
Genome map
AA seq 273 aa AA seqDB search
MMKRQFEDVTRIVIKIGTSSLVLPTGKINLEKIDQLAFVISSLMNKGKEVILVSSGAMGF
GLDILKMEKRPTNLAKQQAVSSVGQVAMMSLYSQIFAHYQTNVSQILLTRDVVVFPESLA
NVTNAFESLISLGIVPIVNENDAVSVDEMDHATKFGDNDRLSAVVAGITKADLLIMLSDI
DGLFDKNPTIYEDAQLRSHVTVITQEIIASAGGAGSKFGTGGMLSKIQSAQMVFENKGQM
VLMNGANPRDILRVLEGQPLGTWFKQIEEVRHD
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaacgacaatttgaagatgtaacacgtatcgtaattaaaattggcactagttca
ttagtgctaccaacaggtaaaatcaatttagaaaaaatcgaccaactggcttttgtgatt
tcaagtttgatgaataagggcaaggaagttattttagtatcatcgggagcgatgggattt
ggactagatattttgaaaatggaaaaacgtccgaccaatcttgctaaacaacaggcagtt
tccagtgttggtcaggtggccatgatgagtctttattcacaaatttttgcacactaccaa
accaacgtgtcacaaattttattgacgagagatgttgtggttttcccagaaagtctagcg
aatgttaccaatgcttttgaaagtctgattagtttgggcattgtgcctattgttaatgaa
aacgatgcggttagtgtggatgaaatggatcatgcgacaaaatttggagataatgaccgt
ctatctgctgtcgttgctggtattacaaaagctgatttattaatcatgttgtctgatatt
gatggcctttttgataaaaaccctactatttatgaggatgcgcagctacgcagccatgtt
acggtcattacgcaagaaatcattgcttcagcaggtggtgcgggcagtaagtttggcaca
ggtgggatgcttagcaaaattcaatctgcccagatggtatttgaaaacaaaggacagatg
gtcttgatgaatggagctaatcccagagatattttaagggtgcttgaagggcaaccacta
ggcacatggtttaaacaaatagaagaggtaaggcatgactga

DBGET integrated database retrieval system