KEGG   Streptococcus dysgalactiae subsp. equisimilis ATCC 12394: SDE12394_09390Help
Entry
SDE12394_09390    CDS       T02017                                 

Definition
Exodeoxyribonuclease V alpha chain
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sdg  Streptococcus dysgalactiae subsp. equisimilis ATCC 12394
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sdg03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1849719..1852193
Genome map
AA seq 824 aa AA seqDB search
MEHFFTGTVDRIIFENAANFFKILLLAIEDTDSDIDDFEIIITGTMADIIEGDDYTFWGE
LTQHPKYGQQLKLSRYQKVKPSSSGLVNYFSSDHFKGIGKKTAEKIIALYGNNTIDHILE
DPSKLETISGLSKANRQAFVAKLKLNYGTEQLIAGLVELGLSNRFAFQAFEKYKEEALDL
VKENPYQLVEDLQGFGFKMADALAENLGIESDSPKRFRAALLHCLLEESVSRGDTYVQAR
QLLDFAITLLEDARQVECDPAAVAEQLSELIIEGKIKNSDTKLFDASLYFAEEGIAKNIS
RLLDTPLSQSFSHDTIQTTIQAVQEDFAITYDQVQQEAIAKALTSKVFLLTGGPGTGKTT
VIRGILQAYANLHQIDLDKKDLPILLAAPTGRAARRMNELTGLPSATIHRHLGLNGDNDY
QAMEDYLDCDLLIVDEFSMVDTWLANQLLAAISSTTQVIIVGDSDQLPSVGPGQVLSDLL
KVNSLPQIALQKIFRQSQESTIVDLADQMRRGILAADFRDKKADRSYFEAQASFIPDMIQ
KIVLSAIKSGIPAEEIQILAPMYKGQAGINHLNQLMQNLLNPLEGQTEFLFNDTHFRKGD
KVLHLVNDAQLNVFNGDIGYITDLIPAKYTESKQDELILDFDGSEVTYPRNEWLKLTLAY
AMSIHKSQGSEFQVVILPITRQSGRLLQRNLIYTAITRSKSKLIMLGEFAAFDYAIKNEG
DKRQTYLVERFQEQSDLASSQPNHELRSKEQTSLFSNTAALEDDSQKSSSQSTNSNPTEN
SQSDNDDFRLTPENYSTIDSMIGLTESDVALFFQKNPRKTDIFD
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atggaacacttttttactggtactgttgaccgcattatctttgaaaatgcagctaatttt
tttaaaattctcctccttgccatcgaagacacagatagtgatattgacgactttgaaatc
attatcacagggacgatggctgacattattgaaggagatgactacaccttttggggggaa
ttgacccagcaccctaaatatggacagcaactcaaactaagccgttaccaaaaagtcaaa
cctagttcatctggtttggttaattatttctccagcgaccattttaaggggattggaaag
aaaacagcggagaaaatcattgccctctatggcaataatactattgaccatattttagaa
gacccaagtaaattagaaactatttctggtctgtccaaggctaatcgtcaagcctttgtc
gctaaactgaaattgaattatggcacagagcaactgattgctggtctcgtcgaacttggc
cttagcaaccgttttgcctttcaagcgtttgagaagtacaaagaagaggctcttgacctt
gttaaagaaaatccctatcaattagtcgaagatctacaaggttttgggtttaagatggca
gatgctctcgctgaaaacttagggattgagagcgactctccaaaacgttttcgtgctgcc
ctcctgcactgcctcttggaagaatccgtcagtcgaggagacacttatgtccaagcacga
caattattagactttgccatcacactccttgaagatgcacgtcaagtagaatgtgaccct
gctgctgtggctgaacaactaagcgagttaatcatagagggcaaaatcaaaaacagtgac
accaaattgtttgatgctagcctttattttgctgaagaggggattgctaagaatatctct
cgtctcttagatacccctttaagtcagtcatttagtcatgataccatccaaacaaccatc
caagccgttcaagaagactttgctatcacttatgaccaggtgcagcaagaagccattgct
aaagccttaaccagcaaggtatttctcctaacaggtggtcccggaacagggaaaacaact
gttattcgaggcattttacaggcttacgctaacctgcatcagattgatttggataaaaaa
gaccttcctatcttgttagcagctccaacaggtcgggctgcacgtcgtatgaatgagttg
actggacttcctagcgcaaccatccacaggcacttaggcctcaacggcgacaacgattac
caagccatggaagattatctagactgcgacttgctgattgtcgatgaattttcaatggtg
gatacctggcttgccaaccaattgttagcagcgattagttcaacaactcaagtaattatt
gtcggagatagtgaccagcttccttcggttggacccggtcaagtcctgtcagatctttta
aaagtcaatagcctgccccaaatcgccttgcaaaagatatttcgtcaatcccaagaatct
actattgtagatttggcagaccagatgcgtcgaggaatcttagctgctgactttcgtgac
aaaaaagctgaccgttcttattttgaagcccaagcctctttcatcccggacatgattcaa
aaaattgttctatctgctattaaaagtggcatccctgctgaggaaattcaaattttagcg
cctatgtacaaaggacaggctggcatcaatcatcttaaccaattgatgcaaaacctcctc
aaccctttggaagggcaaacggaatttctgttcaatgatacgcattttcgtaaaggtgat
aaagtcctgcacttagtcaacgatgctcagttgaatgtctttaacggagatattggttat
attacagatttgattcctgctaaatataccgaatctaagcaagacgaattaatcttagat
tttgacggtagcgaagtcacgtaccctagaaatgaatggctaaaattaaccttagcctat
gccatgagcattcataagtcacaagggagcgagtttcaagtggtgattttacccatcaca
cgccaaagcggccgacttttgcaacgaaatttaatttatactgctatcacccgttctaaa
agtaagttgattatgctaggtgaatttgcagcctttgactatgctattaaaaatgaaggg
gataaacggcaaacttatttggtggaacgcttccaagaacaatccgacttagcctcctct
caacctaaccacgagctaagatcaaaagagcagacctcccttttttctaatacggcagcc
cttgaggacgactctcaaaaatcttcctctcaatcaacaaactctaaccccactgagaac
tctcagtcagataatgatgattttaggttaacacctgagaattattcgactatcgattcg
atgatagggcttacagaatcagatgttgccctctttttccagaaaaatcctagaaaaacg
gacatttttgattaa

DBGET integrated database retrieval system